KEGG   Yersinia enterocolitica WA: CH47_3090Help
Entry
CH47_3090         CDS       T03643                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00230  Purine metabolism
yew00250  Alanine, aspartate and glutamate metabolism
yew01100  Metabolic pathways
Module
yew_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CH47_3090 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH47_3090 (purA)
Enzymes [BR:yew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CH47_3090 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AJI84842
UniProt: A0A0E8GNZ3
Position
complement(3354027..3355325)
Genome map
AA seq 432 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLAPDALMKEMTDLEARGVPVRERLLLSEACPLILPYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLKEIVDYHNFQLVHYYKEE
AVDYQKVLDEVLAIADILTAMVVDVSELLDSARKRGDFMMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYGA
TTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTTP
LAAEGWEGIEPIYETMPGWSEVTFGVKEHSKLPQAALNYIKRVEELTGVPVDIISTGPDR
EETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaacgtcgtcgtactgggcacccaatggggtgacgaaggtaagggcaaggtc
gttgacctgctgactgaacgggctaaatatgttgtgcgctatcaaggtggtcacaacgct
ggccacactttggttatcaacggtgagaaaaccgttcttcatttaattccctcaggtatt
ctgcgtgaaaacgtaaccagcatcatcggcaacggtgttgtactggcacctgacgcctta
atgaaagagatgacagaccttgaagcgcgcggtgtgcctgtacgtgagcgactgttactc
tccgaagcatgcccattaatcctgccatatcatgtggctctggataatgcgcgtgaaaaa
gcacgtggtgcaaaagcaatcggtactaccggtcgtggtatcggccctgcctatgaagat
aaagttgcccgccgcggtctgcgcgtaggtgatttgttcaacaaagaaaccttcgcaatc
aaactgaaagaaattgtggattaccacaacttccagttggtgcactactacaaagaagaa
gcggttgactatcaaaaagtgctggatgaagtattggctattgccgatattctgactgca
atggtagttgatgtttccgaattgctggacagtgcgcgtaagcgtggtgatttcatgatg
tttgaaggcgctcaaggcaccttgctggacatcgaccacggtacttatccgtatgtgact
tcatctaacaccacagcgggtggcgttgcgacaggctctggcctgggcccacgttatgtt
gattacgtgctgggtatcgtgaaagcctattccacccgtgttggtgcaggcccattcccg
actgaactgaacgatgaaacaggtgagttcctgcgtaagcaaggtaacgaatatggcgcg
accactggccgtagccgtcgtaccggttggttggatatcgttgcagtacgtcgtgctgtg
cagatcaactccttgtctggcttctgcatgaccaaactggacgtgctggatggtctgaaa
gaagtgaaactgtgtgttggctaccgcatgccagatggccgcgaagttgataccactcca
ctggctgctgaaggctgggaaggtattgagccaatctacgaaaccatgccaggctggtca
gaagtgacctttggcgtaaaagaacacagcaagttgccacaggcagcgctgaactacatc
aagcgtgtagaagagctgacaggtgttccggttgatatcatctctaccggcccggatcgg
gaagaaaccatgatcctgcgcgacccatttgatgcatga

DBGET integrated database retrieval system