KEGG   Yersinia enterocolitica WA: CH47_3424Help
Entry
CH47_3424         CDS       T03643                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00540  Lipopolysaccharide biosynthesis
yew01100  Metabolic pathways
Module
yew_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CH47_3424 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:yew01005]
    CH47_3424 (rfaD)
Enzymes [BR:yew01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CH47_3424 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:yew01005]
 Unusual sugar
  CH47_3424 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: AJI84683
UniProt: A0A0T9SH13
Position
3727403..3728335
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASI
VAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFCLDRGIPFLYASSAATY
GGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGS
MASVAFHLNNQINAGESPKLFSGSENFKRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRA
ESFQAVADAVVDFHQSGPVEYIEFPEKLKGRYQAYTQADLTNLRAAGYDKPFKTVAEGVK
EYLTWLNRSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtcactggcggcgccggtttcattggcagcaacatcgttaaggcactgaat
aatatcggctataaagatattctggttgtggataacctgaaagacggcaccaaattcgtc
aatctggttgatctggatatcgctgattacatggataaagaagattttgttgccagcatt
gttgctggtgatgatatgggtgatatcgacgcgattttccacgaaggtgcctgttcttcc
accaccgagtgggatggcaagtacatgatggataacaactatcagtattctaaagatatc
ctgcatttctgtctcgatcgcggaatcccattcctatatgcctcctccgccgccacctac
ggcgggcgtactgataatttcattgaagaccgtcagtacgagcaaccccttaatgtttat
ggctactccaaattcctgttcgatcaatatgtgcgcgaaattctgccacaagctgattca
cagatttgtgggttccgttatttcaacgtttatggcccacgcgaaggccataaaggcagc
atggcgagcgtggctttccatctgaacaaccagatcaatgcaggcgaaagccccaaattg
ttctccggcagtgaaaacttcaaacgcgacttcatttatgttggcgatgttgctgacgtg
aatctgtggttctggcaaaacggtgtatccggtattttcaactgtggtacaggtcgtgcg
gaatccttccaggcggttgctgatgcagtggtggatttccaccaaagcgggccagtggaa
tacattgaattccctgaaaaactgaaaggccgttatcaggcatacacgcaagctgatctc
actaatttgcgtgctgccggttacgacaagccgttcaaaaccgtcgccgaaggcgtcaaa
gaatacctgacctggctcaatcgctcagtctaa

DBGET integrated database retrieval system