KEGG   Yersinia enterocolitica WA: CH47_734Help
Entry
CH47_734          CDS       T03643                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase family protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00130  Ubiquinone and other terpenoid-quinone biosynthesis
yew00627  Aminobenzoate degradation
yew01100  Metabolic pathways
yew01110  Biosynthesis of secondary metabolites
yew01120  Microbial metabolism in diverse environments
yew01220  Degradation of aromatic compounds
Module
yew_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CH47_734
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CH47_734
Enzymes [BR:yew01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CH47_734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like Dak2 REF
Motif
Other DBs
NCBI-ProteinID: AJI83112
UniProt: A0A0T9SK13
Position
756684..757256
Genome map
AA seq 190 aa AA seqDB search
MKRLIIGISGASGAIYGVRLLQVLKQVEGIETHLILSNAARQTLALETDFSVKDVQALAD
VVHDSRDIAACVSSGSFKTCGMVILPCSIKTLSGIVHSYTDGLLTRAADVILKERRPLVL
CVRETPLHLGHLRLMVQAAELGAVIMPPMPAFYHRPQTIQDLVDQTVNRVIDQFDIELPE
DLFIRWQGTS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttattattggcattagcggtgccagcggtgccatttatggtgttcgcttg
ttacaggtgctaaagcaggtcgagggcatagaaacccatttgattctcagtaatgcggca
cgccagacgttagcacttgaaacagatttcagcgtcaaggatgtgcaggcgctagcggat
gtggtgcacgattcgcgcgatattgcagcttgtgtttcctcggggtcattcaaaacctgt
gggatggtcattttaccttgttcaatcaaaacactatctggcattgtccatagctatacc
gatggtttattgactcgcgccgctgatgtgatattgaaagagcgtcgcccactggtgctg
tgcgtgcgtgaaacgccgctgcatttaggccatttacggctaatggtacaagctgctgag
ttgggcgcggtcattatgccgccgatgccagcgttttatcaccgcccacagactatccaa
gacctggtcgatcaaacggttaatcgggttatcgatcaattcgatattgagttgcccgaa
gatctatttattcgttggcaaggcactagttaa

DBGET integrated database retrieval system