KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_05801Help
Entry
Y11_05801         CDS       T02010                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00052  Galactose metabolism
yey00500  Starch and sucrose metabolism
yey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Y11_05801
   00500 Starch and sucrose metabolism
    Y11_05801
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Y11_05801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-ProteinID: CBY27601
UniProt: A0A0H3NRB4
Position
618922..620391
Genome map
AA seq 489 aa AA seqDB search
MNPLIERANDALQTLASQVGQNFYPHYHLAPLAGWMNDPNGLIFFNGQYHAFYQHHPYDE
NWGPMHWGHATSHDMLSWQHQSIALAPGDLWDKDGCFSGCAVDDNGVLSLIYTGHVWLKG
EGDDSAIREVQCLATSQDGIHFDKQGVVLNPPVGIMHFRDPKVWFEDDCWWMVVGARDER
DHGQVLLYRGNSLQQWQFMQVLACADDSMGYMWECPDFFPLGNERILMFSPQGLAAKGYL
NRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWSGCLTLPRELSIDCDGNLLIKAVREVEALRQTGEFITSMTLAQEKQLLHENC
QSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDNQANRLVLDRYYPQYGLTGYRS
VALPEQGLLSLRIFIDGSSLEVFINDGQACMSSRIYPTEHERCLSLYAENGQAELLHGEY
WQLVAKSSR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaattgaacgggccaatgatgcactgcaaactttagcttctcaggttggc
caaaatttctatccacattatcatttggctccgctggcagggtggatgaatgaccccaac
gggttgatcttttttaacggacagtatcacgcgttttatcagcaccacccttatgatgaa
aattgggggccgatgcattggggccatgcgaccagccacgacatgttgagttggcaacat
caatccattgccttagcaccgggtgatttatgggataaagacggctgtttttctggttgt
gcggtagacgataatggcgtgttaagcctgatttataccggacatgtttggcttaaaggt
gagggtgatgacagcgctattcgcgaggtgcagtgcctggcaaccagtcaggatggcata
cattttgacaaacaaggtgtggtactgaacccgcccgtgggaatcatgcatttccgcgat
ccgaaagtgtggtttgaagatgattgttggtggatggtggtcggtgctcgagatgagcga
gatcatgggcaagtcttactatatcgcggcaattcattgcagcaatggcaatttatgcaa
gttttagcgtgtgcagacgacagcatgggatatatgtgggaatgtccagatttcttccca
ttagggaatgaacgcattctgatgttttcaccgcaggggctggcagcaaaaggttacctc
aatcgcaatttgttccaaagtggtgtcttacgtggcaaatggcagccaggagccgatttt
aagccatcgcagccttttaccgaactggatctgggccatgatttctatgcgcctcaatcc
ctacttacggctgatgggcggcgagtcattattggttggatggatatgtggcaatcgcct
atgccgaccaaggccgataattggagtggctgcttaaccttgccacgagaattaagtatt
gattgtgatggtaatttattaataaaagcggtacgggaggttgaagcactaaggcaaacc
ggtgaattcatcacatcaatgacactggcccaagagaaacaacttttacatgaaaattgc
cagagtctggaactgcaattgacgtgggataccacagccagtcatgcagaaagatatggg
gtgcagttagctgatgcccaaggaactggtggtaaagtttcggtttatgtcgataatcag
gctaatcgactagttttggataggtattacccacaatatggactgacggggtatcgcagt
gtggcattaccagaacaggggttattatcattacgtatatttattgatggttcgtcgttg
gaggtatttatcaatgacgggcaagcttgtatgagcagtcgtatctacccaaccgagcat
gaacgctgtttatctctgtatgcggagaatggtcaggccgagctactacacggcgaatac
tggcagttagtagctaaatcatcacgttga

DBGET integrated database retrieval system