KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_06751Help
Entry
Y11_06751         CDS       T02010                                 

Definition
(GenBank) sensor kinase CitA, DpiB
  KO
K07701  two-component system, CitB family, sensor histidine kinase DcuS [EC:2.7.13.3]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yey00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y11_06751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:yey01001]
    Y11_06751
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:yey02022]
    Y11_06751
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Y11_06751
Protein kinases [BR:yey01001]
 Histidine kinases
  CitB family [OT]
   Y11_06751
Two-component system [BR:yey02022]
 CitB family
  DcuS-DcuR (C4-dicarboxylate metabolism)
   Y11_06751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a PAS dCache_1 HATPase_c_2 PAS_4 HATPase_c_3 PAS_10 SpoVT_C PAS_7 Gp37 PAS_8
Motif
Other DBs
NCBI-ProteinID: CBY27506
UniProt: A0A0H3NVN0
Position
complement(709095..710771)
Genome map
AA seq 558 aa AA seqDB search
MNNATTAGKQKVPLRLSTSITLMVSAVIISVLLVVHTLFFVQLSKMAQEGLQDKAVAVAR
SLSFSPTIIHGLTDPEAGKQIQSYTSQVQKANNLLFIVVTDMNGIRYSHPNPEMIGQHFI
GNDLEPALQGKENSAINRGVLERALRIFIPVYEPYGKQIGVVAIGISLTSIDSVVSETRW
TIPWTILFGALIGSLGTWFLVKALKRIMLGFEPYEISNLFEQRNAMLQSIKEGVIAVDAN
SRITVVNHEAKRLFKQSGPMENLLLSSASKYWPVRLYLEQVLETGIARRDEEINFNGSIL
LTNTVPVMVKGDIIGAIATFRDKTEVSQLMQRLTGMVHYADALRAQSHEFMNKLHVILGL
LHMKYYQQLEDYIVKTSNNYQAEIGSLLRKVKSPIIAGFLLGKINRARDLGITLSISDDS
LLPDTNNEQITTTLITVLGNLIENAMEAIGNQSQREINVSFHYQNGRVHCVVSDDGPGIA
TELQGSIFDNGFSTKGNEHGIGLSLVRQSLESIGGNIEFDSEAGVFTQFFINLPYEVTSN
NMTSSDNYSNNISAVNHD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgcaacaacggctggaaagcaaaaagtgccgttacgactcagtacatctatc
acactcatggtttctgcggtgattatctccgtgttattggtagttcacacactgttcttc
gttcaacttagcaagatggcacaagagggtttgcaagacaaagccgttgccgtcgcccgg
tcactctctttttcgcccaccatcattcacggattaaccgatcctgaagctgggaaacaa
atacagtcctataccagtcaagttcagaaagcgaataacctgctatttattgttgtgact
gatatgaacggcatacgttattcacatcctaacccagagatgatcggacaacattttatc
ggcaatgatttagaacctgcgctacaaggcaaagaaaacagcgcgataaaccgaggtgta
ctggaaagagcattgcgtatttttattcctgtttatgaaccttacggcaaacaaataggt
gttgtcgcgattgggatttctcttaccagcattgactcggttgtcagtgaaacccgttgg
actattccctggaccatattatttggagcgctgattggatcactcggcacctggttttta
gtcaaagcactgaaaagaattatgttgggttttgaaccctacgagatctccaacttattt
gaacagcgtaacgccatgctgcaatccattaaagaaggcgttatcgcagttgatgccaac
tcgcgcattaccgtggtaaaccatgaggcgaagcgcttatttaaacaaagtgggccgatg
gagaatttattactcagtagtgccagcaagtattggccagtacgtttgtatttagagcag
gtcttggaaaccgggattgcccgacgcgatgaagaaataaactttaatggcagcatatta
ctgaccaatactgttcccgtaatggtaaaaggcgatattatcggcgcaatcgccactttc
cgcgataaaaccgaagtgagtcaattgatgcaacgcctcaccggcatggtgcattatgcc
gatgccttacgagcacagtcgcacgagtttatgaataaactccatgtgattttaggttta
ttgcatatgaagtattatcagcaacttgaagattatattgttaaaacatcgaataattat
caggcggaaattggctctcttctgcgcaaagtaaaatctccgatcattgccggtttcctg
ctggggaaaatcaaccgggcacgcgatttgggtatcacgttatccatcagtgacgatagc
ttgttgcccgataccaataatgagcaaataacgactaccttaattacagttttgggcaat
ctgattgagaatgccatggaagccattggtaaccagtctcaacgagaaattaatgtcagc
ttccattatcaaaatggccgtgtacattgcgttgtcagtgatgatgggccgggtattgca
accgagttgcaaggcagtatttttgataatggtttttccacgaaaggaaatgaacacggc
attggtttgagcctggttcgccaaagcctcgaaagtattggcggcaatattgagttcgat
tcagaagcgggtgtttttacccaattctttatcaacctcccctacgaagtaacctcaaat
aatatgacctccagtgacaattattcaaacaacatcagcgcggtaaatcatgattaa

DBGET integrated database retrieval system