KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_11021Help
Entry
Y11_11021         CDS       T02010                                 

Definition
(GenBank) alcohol dehydrogenase; Acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00010  Glycolysis / Gluconeogenesis
yey00071  Fatty acid degradation
yey00350  Tyrosine metabolism
yey00620  Pyruvate metabolism
yey00625  Chloroalkane and chloroalkene degradation
yey00626  Naphthalene degradation
yey00650  Butanoate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_11021
   00620 Pyruvate metabolism
    Y11_11021
   00650 Butanoate metabolism
    Y11_11021
  Lipid metabolism
   00071 Fatty acid degradation
    Y11_11021
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y11_11021
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y11_11021
   00626 Naphthalene degradation
    Y11_11021
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y11_11021
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Y11_11021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CBY27079
UniProt: A0A0H3NPP4
Position
1126064..1128739
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILEEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPANTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKSFEDAVEKAEKLV
EMGGIGHTSCLYTDQDNQPARVKYFGDKMKTARILINTPASHGGIGDLYNFKVAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKADLGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREFSEELDREEVAVATPAAKAEKKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttcactcaagagcaggttgataaaatcttccgcgccgcagctttg
gctgctgcagatgcccgtattcctctggctaaattagctgtagaagagtcaggcatgggt
attgtggaagacaaagtgatcaaaaaccactttgcttctgaatacatttacaatgcttac
aaagatgaaaagacttgtggcattctggaagaagataaaacctttggtactatcaccatc
gctgaacctatcggtttgatttgcggtatcgtgccaacgaccaacccaacctctactgct
atcttcaaggcgttaattagcctgaagacccgtaacggtatcgtattctctccacatcct
cgtgcaaaagacgcaaccaataaagccgcagatatcgtgcttcaagccgctatcgcagca
ggtgcgccagccgatatcattggttggattgatgcccctacagttgagttatctaaccaa
ctgatgcatcatccagacattaacctgattctggcgaccggtggtccaggcatggttaaa
gcagcttacagttctggtaagccagctatcggtgttggtgcaggtaacacacccgttgtt
gttgatgaaacagcagatatcaaacgtgttgtcgcctctattctgatgtctaaaaccttt
gataacggcgtaatctgtgcgtcagagcagtctatcatcgtcgttgactctgtttatgat
gctgtccgtgagcgcttcgcttcacacggtggctacctgttacaaggcaaagaactgaaa
gctgttcaggatatcatcctgaaaaatggtggcctgaacgccgctatcgtgggtcagcca
gccactaaaattgctgaaatggccggcattaaagttcccgctaataccaagattcttatc
ggcgaagtgaaagttgttgatgaatcagagccattcgctcacgaaaaactgtctcctact
ttggcgatgtatcgtgcgaagagcttcgaagacgcagttgaaaaagcagaaaaactggtg
gaaatgggcggtatcggccatacatcttgcctgtatacagaccaggataatcagccagcg
cgcgttaagtatttcggcgataaaatgaaaaccgcccgaatcttaatcaacacgcctgcc
tctcatggtggtatcggtgacctgtataacttcaaagtagcgccgtctctgacgctgggt
tgcggttcttggggtggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aaaaaaactgtggctaagcgagcagaaaacatgttgtggcataaactcccgaaatctatt
tacttccgccgtggctccctgcctatcgcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacctgttcaacaacggttatgccgatcaaatcacc
agcgtactaaaatctcacggtatcgaaactgaagtcttcttcgaagtagaagcagaccct
accctgagcatcgtacgtaaaggtgcagagcagatgaactccttcaaaccagacgtgatc
atcgcgctgggtggtggttcaccgatggatgctgccaaaatcatgtgggtgatgtacgaa
catcctgaaactcacttcgaagaactggcattgcgctttatggatatccgtaaacgtatt
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcacaaccacatcaggt
accggttcagaagtcacaccattcgccgtagttaccgacgatgcgacaggccagaaatat
ccattggctgactatgcattgacaccagatatggcaatcgttgatgccaacctggttatg
aatatgcctaagtctctgtgtgccttcggtggtctggacgcagtgacccatgctctggaa
gcgtatgtttctgtattggcaaatgaatactctgacggtcaggctctgcaagcgctgaaa
ctgctgaaagaattcctgccagccagttatcacgaaggggcaaaaaatccggttgcacgt
gaacgcgttcacaacgccgcgaccattgccggtatcgcttttgctaacgccttcttgggt
gtctgtcactcaatggcccataaactgggttctgagttccacatcccacacggcctggca
aacgccatgttgatttctaacgttatccgctataacgcgaatgacaacccaaccaaacag
actgctttcagccagtatgaccgcccacaagcgcgtcgtcgctatgctgaaattgcagac
catctgggtctgagtgctccgggcgaccgtaccgcacagaaaatccagaaattgctggct
tggttagatgaaatcaaagctgatttgggcatcccagcgtcaattcgtgaagctggcgtt
caagaagcagacttcctggctaaagttgacaaattgtctgaagatgcattcgatgaccag
tgtacaggtgctaacccacgctacccactgatctccgagctgaaacagatcctgatggat
acttactacggccgtgaatttagcgaagagcttgaccgtgaagaagttgcagtagcaact
ccggcagcaaaagctgagaaaaaagctaaaaagtaa

DBGET integrated database retrieval system