KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_15671
Entry
Y11_15671         CDS       T02010                                 

Definition
(GenBank) type VI secretion lipoprotein/VasD
  KO
K11906  type VI secretion system protein VasD
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yey00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Y11_15671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yey02044]
    Y11_15671
Secretion system [BR:yey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Y11_15671
SSDB
Motif
Pfam: T6SS-SciN DUF3323 Phage_TAC_8
Other DBs
NCBI-ProteinID: CBY26614
UniProt: A0A0H3NQA7
Position
complement(1570647..1571183)
AA seq 178 aa
MKKNIRWFNRITQYFFVALVTLLVMACSSKPKPEPVDKLSVELTTAKNINPNDKGVANPL
RITVYTLKNTDEFKSSDFFTITEEGTPSLKEQMEKVFDGIMLPNETKTIELTLNSGVTAI
GVVAAYREIEQAEWNAVFSPLPKKRVQPWYKKWWSGKQNEPVVKVRVERRSISIKEMD
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatatccgttggtttaatcggattacacaatactttttcgtggcattggtc
acgctattggtcatggcatgtagctcgaagcctaaacccgaaccggttgataaattgagc
gtcgagctgactacggcaaaaaatatcaatccaaatgacaaaggtgtcgctaatccgtta
aggatcacagtttataccctgaagaatacggatgaatttaagtcgagtgatttcttcact
attaccgaagagggtactccatctctgaaagagcagatggagaaagtgtttgacggaatc
atgctacctaatgagacaaaaacaatagaactgacgctaaacagtggcgtcactgccatc
ggcgtcgttgctgcttaccgtgaaattgagcaggcggagtggaacgcggtttttagcccg
ttacccaagaaacgcgtgcagccctggtataaaaaatggtggtcagggaaacaaaacgaa
ccggtagtcaaggtgcgcgttgagcgtcggtcaatatcaatcaaagaaatggactaa

DBGET integrated database retrieval system