KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_15681Help
Entry
Y11_15681         CDS       T02010                                 

Definition
(GenBank) uncharacterized protein ImpD
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yey00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Y11_15681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yey02044]
    Y11_15681
Secretion system [BR:yey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Y11_15681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CBY26613
UniProt: A0A0H3NYU7
Position
complement(1571405..1571890)
Genome map
AA seq 161 aa AA seqDB search
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCVTH
YIDKASPNLLSYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANQQS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagatatgtttattaaaattgatggtatcgaaggtgaatctttagatgctaac
cacaaaaacgaaattcaggtgctggcttggaaatgggacgtttctcagcactcaaatatg
cacagtggctcaggcggtggttcaggtaaagcaactgtttctgacttctgtgtcacgcat
tatatcgataaagcaagcccgaacttattgagctattgcttgttgggtaagcatattaag
aatatccaattcgttctgcgtaaagcaggtggcgatccactggaatacctgactattaaa
tttaccgatgtaatcatcactcgtgttgatatggccggttctcttgaagatgaaactcgt
ccacgtgaagaaattcgtttctcattcaccaagatgactcaagactacgttatgcagaat
gctgaaggccataaatctggcgttatttctgctaactacgatgttaaagctaaccagcaa
agctaa

DBGET integrated database retrieval system