KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_15701
Entry
Y11_15701         CDS       T02010                                 

Definition
(GenBank) uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Brite
KEGG Orthology (KO) [BR:yey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yey02044]
    Y11_15701
Secretion system [BR:yey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Y11_15701
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBY26611
UniProt: A0A0H3NTG4
Position
complement(1573742..1574194)
AA seq 150 aa
MEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNFDERMKAMKPRVAFA
VKNTLTGEGQLMVDITFESLNDFSPDEIAKKVDSLSQLLDARTQLANLQTYMDGKAGAEE
LVMKLLKDKSLLATLASAPKTKQSAADAPQ
NT seq 453 nt   +upstreamnt  +downstreamnt
gtggaaatatatggaagtgagaaaaaggttgaattgccattcgtcatgggcgtgctggct
gatttatccggtaagcctcttgaacctttaccttcagtagcagatagaaagctgctggat
atcgacatcgataatttcgatgagcgtatgaaagcaatgaaaccacgagttgcatttgct
gtgaaaaatacgctgacgggtgaaggccagttgatggtggatattacttttgagagcctg
aatgacttttctcccgatgaaattgctaagaaagtcgattctctgtctcaattgttagat
gcccgtactcaattggcaaacttgcaaacctatatggatggcaaggcaggtgcagaggaa
ttagtaatgaaacttctgaaagacaaatcattactggcaacactggcatccgcaccgaaa
acaaagcaatccgctgctgatgctccacagtaa

DBGET integrated database retrieval system