KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_31831Help
Entry
Y11_31831         CDS       T02010                                 

Definition
(GenBank) autolysin sensor kinase
  KO
K02478  two-component system, LytTR family, sensor kinase [EC:2.7.13.3]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Brite
KEGG Orthology (KO) [BR:yey00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:yey01001]
    Y11_31831
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:yey02022]
    Y11_31831
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Y11_31831
Protein kinases [BR:yey01001]
 Histidine kinases
  LytTR family [OT]
   Y11_31831
Two-component system [BR:yey02022]
 LytTR family
  Unclassified
   Y11_31831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5TM-5TMR_LYT His_kinase ECF-ribofla_trS GAF_3 GAF_2 SpoVT_C ECF_trnsprt
Motif
Other DBs
NCBI-ProteinID: CBY29347
UniProt: A0A0H3NWE4
Position
complement(3299930..3301627)
Genome map
AA seq 565 aa AA seqDB search
MGVSQVELIFSLLQQMCVYLVIAYLLSKTPLFIPLMQVTIRLPHKLVCYLTFSMFCIMGT
YFGLHIDDSIANTRAIGAVLGGVLGGPSVGFLVGLTGGLHRYSMGGMTATACMLSTITEG
LLGGLLHSYLIRKNRLDLLFQPLVVAAITLVAEVLQMLIILAVARPFHEAVELVENIALP
MMITNTIGAAMFMRILLDRRAIFEKYTTAFSAKALQIAARAEGLLRHGFDQQNSMRVARI
LYEELGVGAVAITDREKLLAFIGTGSDHHKVGGAITSDHTHRAIELNQVVYADGNAVPYT
CSISPTCKLGSTLVIPLRGEEHRVIGSIKLYEPKTKLFSSINRTLGEGIAHLLSAQILAG
EFEQQKQMLAQSEIKLLHAQVNPHFLFNALNTLSVVIRRNPDHARKLVLSLSTFFRKNLK
RSHDVVTLSDEIEHVNAYLEIEKARFADRLSVEISLPDELMEARLPAFSLQPVVENAIKH
GISQMFSNGRITLHGKLDEHVLVLEVEDNAGLYQPRPNGDGLGMNLVDRRIKVRYGSEYG
VTVINKAEEFTRIIIKLPFITASES
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttagccaggtagaactgattttttcccttttacaacagatgtgtgtctatctg
gtcatcgcctatctgttgagcaaaacaccgctatttatccccttaatgcaggttaccatt
aggttgccccataaactggtgtgctacctcacgttttccatgttttgcatcatgggaacc
tattttggtttgcatattgatgactccatcgccaatacccgcgctatcggtgccgtatta
ggtggcgtgttgggggggccatcagtcggttttctggtggggctaacgggcggcttacat
cgctactccatgggaggaatgaccgccaccgcctgtatgttatctaccatcaccgaaggg
ttattaggcgggctactccatagctatttgatccgcaaaaatcgcctcgacctgttattc
cagcccttggttgtcgccgctattactttggtggccgaagtcctgcaaatgttgattatt
ctggcagtagcgcgccccttccatgaagcggtcgaattggttgagaacattgccttgccc
atgatgataactaacaccatcggtgccgcaatgtttatgcgtatcttattggacaggcgg
gctattttcgaaaaatacaccaccgcattctcagccaaagcgttacaaattgccgcgcga
gcggaagggttattacgccacggttttgatcagcaaaacagtatgcgagtggcgcgtatt
ttgtatgaagaactgggtgtgggcgcggtagcaatcactgaccgtgagaaactgctggcg
tttattggcaccggctcagaccaccataaagtgggaggagccattacttccgaccatacc
caccgggcgattgagctgaatcaggtggtctacgccgacggcaacgccgtaccctatacc
tgttcaatttcaccgacctgtaagctaggttctaccttggttatcccgttacgtggcgaa
gagcatcgagtgattggcagcatcaagttgtatgaaccgaaaaccaagctgttctccagt
atcaaccgcacattgggtgaaggcattgctcacctgctatcggcccaaattctggccggt
gaatttgagcagcaaaagcaaatgctggcacaatccgaaatcaaactgctccatgcgcag
gtcaacccgcattttctgtttaatgcgctcaatactctgtcagtggtgatccggcgcaat
ccagaccatgcccgtaaactggtactgtctctgtcgacattctttcgcaaaaacctcaaa
cgcagtcatgatgtggtcacattgagtgatgaaattgaacatgtgaatgcttatctggaa
atagaaaaagcacggtttgcagatcgcctgagtgttgaaatttcattaccagatgagttg
atggaagcgcgtttaccggcattttcgctacaaccggtggtagaaaatgccatcaaacac
ggtatttcgcagatgttcagcaatggtcgtatcaccttgcatggcaagttggatgagcat
gttctggtgctggaagtcgaggataatgccggattgtatcaaccgcggccaaatggcgat
gggttgggtatgaacctggtggatcggcggattaaagtgcgttatggcagtgaatacggt
gtaaccgtaataaataaagccgaggaattcacccgcatcatcattaaactgccgtttatc
accgcaagtgagagctaa

DBGET integrated database retrieval system