KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_37841Help
Entry
Y11_37841         CDS       T02010                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00052  Galactose metabolism
yey00500  Starch and sucrose metabolism
yey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Y11_37841
   00500 Starch and sucrose metabolism
    Y11_37841
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Y11_37841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CBY28746
UniProt: A0A0H3NU23
Position
complement(3931739..3933148)
Genome map
AA seq 469 aa AA seqDB search
MQEASLLKHLTLAVMRGQTRALQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LYCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENKRGEFDKLGPVLPLPAGYTGHVRDPKVWQHDGQWYMVLGAQDQQ
LQGKVLLLRSGDLREWHNLSEIAGSGLGGLGPFGYMWECPDLFTLADKDVLIFCPQGIPA
EAERYRNTFQAGYLLGKLDYANATFNHQAFHELDAGFEFYAPQTTLAADGRRLLFGWMGI
PDEDEFYQPTVEYGWIHTMTCPRELSLNGDKLIQQPARELAALRCEHTQWQGRAQEAPDL
AIGSAEMIIDVSAPFTLELGNTLLLEWDGACLILSRNNLRTGLREFRYWRGQLQQLQLLC
DRCSIEIFINQGQAVMTSSYFPPGAPQAIFAGSAELRVQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccagtttgcttaaacatcttacgctggcagtgatgcgcggtcagacccgc
gcattacaagacccacaccggccgggctggcacttagcgccctgtgtcgggttgctgaat
gatcccaatgggtttatttatcatgctggctattatcatctgttttatcaatggaatccg
ctgtattgccgccacggcagtaaatattggggccactggcgcagcactgacttagtgcat
tgggaacatcaaccagtggcattggtgccgagcgaagcctatgaaagtcatggttgttac
tccggttcggcggtgattgctgatgaccttatcaccttgatttacaccggaaatgtgaaa
taccccgatggctcccgtaccgcattccaatgtctggcacaggaaaataaacggggcgag
ttcgacaagttagggccagtgctcccattgcccgctggctataccggacatgtgcgtgac
ccgaaagtctggcagcacgacggccagtggtacatggtgttaggcgctcaggaccaacaa
ctacaaggcaaggtgctactgctgcgctctggtgatttacgcgaatggcataacctcagt
gagatagctggctctggtctgggggggcttgggccttttggctatatgtgggaatgcccc
gacctatttaccctggcagataaagacgttttgattttctgcccacagggtataccagca
gaagctgaacgctatcgtaatacctttcaggccggctatttactgggcaaattagattat
gccaacgccaccttcaatcatcaggcattccacgagttggacgctggctttgagttctat
gcgccgcaaaccacgctagccgcagatggtcgtcgcttattattcggctggatgggcatt
ccagatgaagatgaattttatcaaccaacagtggaatatggctggatccacaccatgact
tgcccacgcgagttgagtcttaatggcgacaaactgattcagcaaccggcccgcgagtta
gccgcgctgcggtgtgaacatacgcagtggcaaggccgtgcccaagaagcccctgatctt
gcgatcggtagcgccgaaatgataatcgacgtcagtgcgccttttaccctcgaattgggc
aatacactgctgttggaatgggatggtgcgtgcttgattttaagccgtaataatctacgc
accggattgcgggaattccgttactggcgcggtcaactgcaacaattacagttactttgt
gatcgttgcagcatagagatttttatcaatcagggacaagcggtgatgacgtcgagttac
ttcccaccaggagcgccacaagccatttttgcgggaagtgctgaactgcgagtgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system