KEGG   Yersinia enterocolitica subsp. palearctica Y11 (serotype 0 3): Y11_38131Help
Entry
Y11_38131         CDS       T02010                                 

Definition
(GenBank) nadr transcriptional regulator; Nicotinamide-nucleotide adenylyltransferase, NadR family; Ribosylnicotinamide kinase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11 (serotype:0:3)
Pathway
yey00760  Nicotinate and nicotinamide metabolism
yey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Y11_38131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yey03000]
    Y11_38131
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     Y11_38131
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Y11_38131
Transcription factors [BR:yey03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Y11_38131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 Citrate_ly_lig CTP_transf_like MMR_HSR1 AAA_16 ABC_tran HTH_37 AAA_29 FAD_syn HTH_35 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: CBY28717
UniProt: A0A0H3P0N4
Position
3964654..3965937
Genome map
AA seq 427 aa AA seqDB search
MLQFDYLKTAIKQKGCTLQQVADASGMTKGYLSQLLNDKIKSPSAQKLEALHRYLELEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHIILCYDEPRDLELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDENGIEPYPHGWDVWSLGVKKFMNEKGIVPNFIYSSES
QDAPHYREQFGIETILIDPERSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SERDRKSFQNLLEQMLRSNNIEYVHVESADYDERFLRCVELVQQLLAADLQRLARPSLLS
EAREGQL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttcgactatctcaaaacagcgattaagcaaaaaggctgtaccttacagcaa
gtggcagatgccagcggcatgaccaaaggttatttaagccagttactcaatgataaaatc
aaaagtcccagtgcacaaaagctagaagccttgcaccgctaccttgagctggagtttccg
cgccgtgagaaaaaagttggcgtggtgtttggtaaattttacccactgcataccggccat
atctatctcattcaacgtgcttgtagtcaggtcgacgaactccacattatcctttgttac
gatgagccgcgcgatttggagctgtttgagaacagttcaatgtcacagcaaccgaccgtc
agcgaccgcttgcgttggttactacaaacctttaagtatcagaaaaacattcatattcat
tcatttgatgaaaatggtattgaaccctatccacatggctgggatgtctggagccttggg
gtcaaaaagttcatgaatgagaaggggatagtgccgaatttcatctattccagtgaaagc
caggatgcgccacattatcgcgaacaatttggtatcgaaaccatcttgatcgaccctgaa
cgctcctttatgaatatcagtggccgccagatccgccgcgatcctttccgctactgggat
tatattccgaccgaagtgaaaccgttttttgttcgcaccgtggcgatactggggggcgaa
tccagtggaaaatccacgttggtcaataagttagccaatattttcaacaccaccagtgcg
tgggaatatggccgcgactatgttttctcccacttgggcggcgatgagatggcgctgcaa
tattccgattatgacaagattgcattggggcaagcgcaatacgttgattttgcggttaaa
tatgctaataaagtcgcttttatcgataccgactttgtcactacgcaggcattttgtaaa
aaatatgaagggcgcgagcatccatttgttcaggcgctgattgatgaatatcgctttgat
ctggttattttgctggaaaataacacgccgtgggtggctgatggtttgcgcagtctgggc
agtgaacgtgaccgcaaatcgttccaaaatttactggaacagatgttgcgcagcaacaat
attgaatacgtccacgttgagtcggcagactacgacgagcgcttcttgcgctgtgtcgaa
ctggtgcaacagctattagccgccgatttgcaaagattggcccgcccttcattgttgagt
gaagcgcgggaagggcaactttag

DBGET integrated database retrieval system