KEGG   Yersinia frederiksenii: AW19_2272Help
Entry
AW19_2272         CDS       T03606                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
yfr  Yersinia frederiksenii
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yfr03016]
    AW19_2272
Enzymes [BR:yfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AW19_2272
Transfer RNA biogenesis [BR:yfr03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AW19_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJI88291
UniProt: A0A0B6FTU3
Position
complement(2448946..2449719)
Genome map
AA seq 257 aa AA seqDB search
MLEILYQDEHIVAVNKPAGWLVHRSWLDSNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSDVARALSLQFEQHQIQKTYHAVVRGYVLEDGTIDYEMTEELDKIADKFARPDK
APQPSVTHYHALAQVEVPIAIGRYDTARFSLMELKPETGRKHQLRRHMAHIRHPIIGDST
HGDLRQNRGIAEHFDCSRLMLHASHLHLNHPVTGEPLNLTARWDDSWQQLMSHFGWRGIT
PHLERVEFPATAGQDSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatactttatcaagatgaacatatagttgcggtcaataaaccggctggctgg
cttgtccaccgcagttggttggatagcaacgaaactgtatttgtaatgcaaacagtacgc
gaccagattggccagcatgtttataccgtccatcgactggatcgcccgacatcaggtgtg
ttgctgatggcgctgtccagtgatgtggcccgtgccctttcattacaatttgagcagcat
caaattcagaaaacatatcatgcggttgtacgtggatatgtactggaagatggcacgatt
gattacgagatgaccgaagagttagacaaaattgcggataaatttgcccggccagataaa
gccccgcagccttcggttacccattatcacgcactggctcaagtggaagttcccattgcc
attgggcgctatgacactgcgcgctttagtttaatggaattaaagccagaaacagggcgt
aaacaccagctacggcggcatatggcgcacattcgccaccctatcatcggtgacagcacc
catggcgatttacgccaaaatcgtggaattgctgagcattttgattgttcacggctcatg
cttcatgccagccatttgcatctgaatcaccctgtcaccggagagccactcaatttgacc
gcgcgttgggatgattcctggcaacagctgatgtcacattttggctggcggggtattacc
cctcatcttgaaagggttgagtttccagcaactgcaggtcaggatagtgcgtaa

DBGET integrated database retrieval system