KEGG   Yersinia frederiksenii: AW19_3322Help
Entry
AW19_3322         CDS       T03606                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00051  Fructose and mannose metabolism
yfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AW19_3322 (mtlD)
Enzymes [BR:yfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AW19_3322 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N SpoU_sub_bind UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AJI85979
UniProt: A0A0B6FEH3
Position
3596815..3597978
Genome map
AA seq 387 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKSYQVNVVGEQARVEEV
KNVSAVNSGSPEVVALIADADIVTTAVGPQILARIASTVAQGLVARHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFAVLPESEQAWVEQHVGFVDSAVDRIVPPSEAGSTDILAVTVETFS
EWIVDGTQFKGQPPQIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DSAVRQSVKGAMEESGAVLIKRYAFDPQRHAAYINKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHNNLVTGIAAAMSYRSEQDPQAQELVELLAKLGPKATLAQ
ISGLPADSEVVEQVVSVYNAMQDKLAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcgggtaatattggccggggcttcattggtaaacttctt
gctgatgccggtgcacaactcactttcgccgatgtgaaccagccgttgttggatgaactg
aataagcgtaagagttatcaggttaatgtggtgggtgagcaagcccgtgttgaagaagtg
aaaaatgttagcgcagtgaacagtggtagcccggaagtggtggcactgattgctgatgct
gatattgtcactaccgctgttggcccacaaattttggcccgcatcgccagcaccgtggcg
caaggtttggtggcccgtcatcaacaaggtaatacccgcccactgaatattattgcttgt
gagaatatggtgcgcggcactagccagttaaaacagcatgtgtttgccgtcttgccagaa
agtgagcaagcgtgggttgagcaacatgttggttttgttgattctgcggtagaccggatt
gtgccgccatcagaagcgggcagcactgatattctggccgtgacagtagaaacattcagc
gagtggattgttgatggtacccaatttaaagggcagccgccgcaaatcgccggtatggaa
ctgacggataacctgatggcctttgtggagcgcaaactcttcacgctgaacaccgggcat
gccattaccgcctatttgggccagcttgcagggcaccaaaccattcgtgatgccattctt
gactcagccgttcgccagagcgtgaaaggcgcgatggaggagagtggggcagtgctgatc
aagcgctatgcttttgatccgcagagacatgcagcttatatcaataaaattctctcccgt
ttcgaaaacccttacctgcatgacgatgttgagcgcgttggccgtcagccactgcgtaaa
ctgagcgctggtgaccgtttgatcaagccgctgttggggacgttggaatatcagttgcca
cataataacctggtgaccggtattgctgctgcgatgagttatcgcagtgagcaagatccg
caagcgcaggaactggttgaattactggctaaattagggccaaaagccactcttgctcaa
atttccggtctgccagctgatagcgaggttgtggaacaggtggtgagtgtgtataacgcc
atgcaggacaagctggcgcactga

DBGET integrated database retrieval system