KEGG   Yersinia hibernica: D5F51_00370Help
Entry
D5F51_00370       CDS       T05961                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
yhi  Yersinia hibernica
Pathway
yhi00540  Lipopolysaccharide biosynthesis
yhi01100  Metabolic pathways
Module
yhi_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    D5F51_00370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:yhi01005]
    D5F51_00370
Enzymes [BR:yhi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     D5F51_00370
Lipopolysaccharide biosynthesis proteins [BR:yhi01005]
 Unusual sugar
  D5F51_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: QAX77169
UniProt: A0A481Q9F3
Position
complement(80317..81249)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDIGYKDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASI
VAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFCLDRGIPFLYASSAATY
GGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGS
MASVAFHLNNQINAGENPKLFSGSENFKRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRA
ESFQAVADAVVDFHHSGPVEYIEFPEKLKGRYQAYTQADLTNLRAAGYDKPFKTVAEGVK
EYLAWLNRSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtcactggcggcgccggttttattggcagcaacatcgttaaggcactgaat
gatataggctataaagatattctggttgtagataacctgaaagacggcactaaattcgtc
aatctggttgatctggatatcgctgattacatggataaagaagattttgttgccagcatt
gttgccggtgatgatatgggtgatatcgacgcaattttccatgaaggtgcctgttcttcc
accactgagtgggatggcaagtacatgatggataacaactatcagtattctaaagatatc
ctgcacttctgtctggatcgcggcatcccgttcttgtatgcctcatcggcggccacctat
ggcgggcgtactgataatttcattgaagatcgtcaatacgaacaaccacttaacgtttat
ggttactccaaattcttgtttgaccaatatgtgcgcgagatcctgccgcaagccgactca
cagatttgtgggttccgctatttcaacgtttatggcccgcgtgaaggccataaaggcagc
atggcgagtgtggctttccatctgaataatcagataaatgcgggtgaaaaccctaaactg
ttctccggtagcgaaaacttcaaacgcgatttcatctatgtcggtgatgttgccgacgtt
aacctgtggttctggcaaaacggagtctccggcattttcaactgcggcacgggtcgcgcg
gaatccttccaggcagtggccgatgcagtagtggatttccaccacagcgggccggtggag
tacattgaattcccagaaaaattgaaaggccgctatcaggcatacacgcaagctgacctg
accaatttgcgtgctgccggttatgacaagccgttcaaaaccgtcgccgaaggcgtcaaa
gaatacctggcctggctcaaccgctcagtctaa

DBGET integrated database retrieval system