KEGG   Yersinia hibernica: D5F51_04525Help
Entry
D5F51_04525       CDS       T05961                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
yhi  Yersinia hibernica
Pathway
yhi00860  Porphyrin and chlorophyll metabolism
yhi01100  Metabolic pathways
yhi01110  Biosynthesis of secondary metabolites
yhi01120  Microbial metabolism in diverse environments
Module
yhi_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
yhi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:yhi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D5F51_04525 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:yhi01007]
    D5F51_04525 (hemL)
Enzymes [BR:yhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     D5F51_04525 (hemL)
Amino acid related enzymes [BR:yhi01007]
 Aminotransferase (transaminase)
  Class III
   D5F51_04525 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QAX77877
UniProt: A0A481QB29
Position
complement(938764..940044)
Genome map
AA seq 426 aa AA seqDB search
MSKSESLYAQAKQLIPGGVNSPVRAFTGVGGVPLFIERADGAYLFDVDGNAYIDYVGSWG
PMVLGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRKTFEQYPQDVACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLTEVAQVGIHETLTELTDSLATGLLHAAKAENIPLVVNHVGGMFGIFFT
DAPTVTCYQDVMNCDVERFKHFFHLMLEEGIYLAPSAFEAGFMSVAHSPEDIQKTVNAAR
RCFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatccgaaagtctgtatgcccaggcaaaacagctaatcccaggcggggttaac
tctccggtgcgtgctttcaccggtgtcggtggcgtcccattattcattgaacgtgctgat
ggcgcttatttatttgatgtggatggtaatgcctatattgattatgttggttcttggggg
ccaatggtcttggggcacaatcacccggcaattcgtcaggccgtgattgaagcagtcgaa
cgcggtctgagctttggcgcaccaacagaaatggaagtcaaaatggctgaattggtaacc
aatttagtcccgaccatggatatggtgcgcatggtcaactccggtacagaggcgaccatg
agtgccattcgtttggcccgaggcttcactggtcgcgataaaattatcaagtttgagggt
tgctatcatggccatgcagattgtctgctggtaaaagcgggttcaggcgccttaacactt
ggccaacctaactctccaggcgtgcccgcagactttgcgaagcataccctgacttgtacc
tataatgatttagcctccgtgcgcaaaacctttgagcaatatccgcaagacgtggcttgt
atcattgttgaacctgtcgccggtaatatgaattgcgttccccccttaccggagttcctg
cccggattacgcgcattatgtgatgagtttggcgcgctgttaattattgatgaagtcatg
accggttttcgtgtggcattagccggagcgcaggattattacggtgttgtccctgatttg
acctgtctggggaaaattattggcggcggtatgccggtgggggcgtttggtggtcgtcgc
gatgtcatggatgctctggcaccaacaggcccggtttatcaggcgggtacactatccggt
aacccaattgccatggcggccggttttgcttgcctgactgaggtggctcaggttggtatt
catgagaccctaacagagttaaccgactctctggcgactggtctgctacatgccgcgaaa
gcagagaatattccactggtagttaaccatgtaggggggatgttcggcatattctttacc
gatgctccaaccgtgacttgctatcaggatgtgatgaactgcgacgtcgagcgattcaag
cacttcttccatttgatgctagaagaaggtatttatctggctccgtcggcttttgaagcg
ggctttatgtccgtggcgcacagcccagaagatatccagaaaactgtgaatgcggctcgt
cgctgttttgccaagctttaa

DBGET integrated database retrieval system