KEGG   Yersinia intermedia: CH53_2124Help
Entry
CH53_2124         CDS       T03608                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
yin  Yersinia intermedia
Pathway
yin00071  Fatty acid degradation
yin00280  Valine, leucine and isoleucine degradation
yin00310  Lysine degradation
yin00362  Benzoate degradation
yin00380  Tryptophan metabolism
yin00620  Pyruvate metabolism
yin00630  Glyoxylate and dicarboxylate metabolism
yin00640  Propanoate metabolism
yin00650  Butanoate metabolism
yin00900  Terpenoid backbone biosynthesis
yin01100  Metabolic pathways
yin01110  Biosynthesis of secondary metabolites
yin01120  Microbial metabolism in diverse environments
yin01130  Biosynthesis of antibiotics
yin01200  Carbon metabolism
yin01212  Fatty acid metabolism
yin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH53_2124
   00630 Glyoxylate and dicarboxylate metabolism
    CH53_2124
   00640 Propanoate metabolism
    CH53_2124
   00650 Butanoate metabolism
    CH53_2124
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH53_2124
   00072 Synthesis and degradation of ketone bodies
    CH53_2124
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH53_2124
   00310 Lysine degradation
    CH53_2124
   00380 Tryptophan metabolism
    CH53_2124
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CH53_2124
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH53_2124
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH53_2124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yin04147]
    CH53_2124
Enzymes [BR:yin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CH53_2124
Exosome [BR:yin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CH53_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJJ21309
UniProt: A0A0T9MDX8
Position
complement(2396084..2397268)
Genome map
AA seq 394 aa AA seqDB search
MDNIVIVSAVRTAIGSFNGALAPVSAVDLGSIVLREAMARAGISGDNVDEVILGNVLQAG
LGQNPARQALLKSGIPDTVSAYTVNKVCGSGLKSVALAAQAILAGDAQTIIAGGMENMSQ
APYLMDSKARWGYRLGDGQLFDVILKDGLMCATHDYHMGITAENVAKEYGISREAQDALA
LASQQKAVAAISSGAFAQEIVPVTVKNRKGDITVDTDEFPKAGTTAEGLAKLRPAFSKDG
TVTAGNASGINDGAAALVVMSESRARQLGLTPLARIRGYASGGVAPALMGMGPVPATLNV
LKKTGLALSDIDLIEANEAFAAQFLAVGKTLGFDAEKVNVYGGAIALGHPIGASGARILV
TLLHALQARNKTLGLATLCIGGGQGTAMIIERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggataacatcgttattgtcagtgccgtacgcacggcgattgggagttttaatggcgca
ttggcaccggttagcgcggtcgatttaggttcaatcgtactccgtgaagccatggccaga
gccggtatcagcggtgataatgttgatgaagtcattttgggtaatgtacttcaagctgga
ttgggccaaaaccctgcgcggcaggctctattgaaaagcgggatacctgataccgtcagt
gcctacaccgtcaataaagtgtgtggctctggtttgaaaagcgtggcattagcggctcag
gcaattttagccggcgatgcccagaccattatcgccggtggtatggagaacatgagccag
gcaccttacctgatggatagcaaagcacgctggggctatcgactgggtgatggccagcta
tttgacgtgatcttaaaagacggtttgatgtgtgccacccatgattaccatatgggtatt
acggcagaaaatgtcgcaaaagaatatggcattagtcgtgaagcacaagatgcgctggcg
ttagcatcacagcagaaagctgtagccgctatctcaagcggtgctttcgcacaagagatt
gtgccagtgacagtgaaaaacaggaaaggcgacatcactgtagataccgatgagttccct
aaggccggtaccacggcggaaggtttggcaaaattgcgcccggcgtttagtaaagatggc
accgttaccgcaggcaacgcgtcgggtattaatgatggtgcggctgcattggtggtgatg
tcagaaagccgcgccaggcagttaggcttgactccactagcccgtatccgaggttatgcc
agtggcggcgtagccccagccttgatgggcatggggccagtaccggcaacccttaatgtg
ctgaaaaaaaccgggttggcgctatccgatattgatttgattgaagccaacgaagctttc
gccgcgcagttcttggcggtaggtaaaacattggggttcgatgcagaaaaggttaacgtc
tacggcggtgccatcgcactagggcacccaatcggcgccagcggtgcacgaattctggtc
acgctgctgcacgccttgcaagcccgcaataaaaccttggggctggcaacactgtgtatc
ggcggagggcaaggtacagcaatgattattgagcggctgaattaa

DBGET integrated database retrieval system