KEGG   Yersinia intermedia: CH53_2526Help
Entry
CH53_2526         CDS       T03608                                 

Definition
(GenBank) glycosyl hydrolases 43 family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yin  Yersinia intermedia
Pathway
yin00052  Galactose metabolism
yin00500  Starch and sucrose metabolism
yin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CH53_2526
   00500 Starch and sucrose metabolism
    CH53_2526
Enzymes [BR:yin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CH53_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_43 DUF4975 Glyco_hydro_130 Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AJJ18514
Position
complement(2842056..2843549)
Genome map
AA seq 497 aa AA seqDB search
MKKLISSVLVALLAFSVGNMPVYSQQSKETLQNKSITRINDFFPLVEGSFIGDPMPVYNE
GEFDIFYLNDVRGGSDLGVHAIHLLSSANLYHYQNHSEVIPYVNDVNDPELLLGTGSIIK
VGDTWHAWYTAHNENVFPVESIMHATSKDRLHWVKHPQDTILPGVNYRGNDFRDPHVVWV
EEKKEYWMLITTRSSGRGIIARYSSTDLKNWEDRGIFFDNDTITSNSNLECPTLVFFNGR
WYLSFSDQWPLRLTQYRVADNPDGPWRKLDNYVVDGSGFYAGKLAIKDDRLFVFGWIPTK
AGNSDRGNIDWAGNLVAHELTADAQGQLNSVIPQELQTVINDNRGPVYTIDHVKTLKTAT
PFGLLQSSVYSPLPRRGELTATVDVPSAGMVMSFGLTGDSVSDAPLNVVFNKSKGKVYFF
NSPLATIHQANAESWVDVPLGENVELRVLIQDSIAIFYINNKAAFSTRMYSMPEKPWSIS
LPQNDNFHAILKIKEMI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatttcatcggtactcgttgctctgcttgcgttttccgtagggaatatg
cctgtatattcacaacagtctaaagaaacattacagaataaaagcatcacccgtattaat
gactttttccctctggtggaggggtcatttattggcgatccgatgcctgtctataacgaa
ggcgaattcgatattttttatcttaatgacgtacgaggcggcagcgatttaggcgtgcat
gcgattcacctgctgtccagcgccaatttatatcattatcagaaccattcagaagttatt
ccttacgttaatgacgttaacgatccagaactgctcctggggaccggctctattatcaaa
gtgggcgatacttggcacgcgtggtataccgcacataatgaaaacgtattcccagttgaa
tcaatcatgcatgccaccagtaaagaccgccttcactgggtgaaacacccgcaggacact
attctgccgggcgttaactatcgaggtaatgacttccgtgatcctcacgtcgtctgggtt
gaagaaaagaaagagtactggatgctgattaccacccgcagtagcggtcgcggcattatt
gcacgttacagttcaacggatttaaaaaactgggaagatcgcggcatattttttgacaac
gataccatcaccagtaattcaaaccttgaatgccctacgttagtcttctttaacgggcgc
tggtatctgagcttcagcgatcaatggccgctgcgcctgacgcagtatagggttgcggac
aatccagacgggccatggcgcaagctggataactatgttgtggatggttcaggtttttat
gcaggcaaattagcaataaaagacgatcgtttgtttgttttcggctggatcccgaccaaa
gcaggaaacagtgacagaggcaacatcgactgggcaggaaatctggttgctcatgaactg
accgctgatgctcaggggcagctcaatagcgtcatcccgcaggaacttcagacggtcatc
aatgacaaccgtggtccggtttacaccatagatcatgttaaaacgctaaaaacggcaacg
ccgtttggcctattacagtcatctgtttattcgccactgcccagacgtggagaactgact
gcaacagtggatgttccctccgcaggaatggtcatgagctttggtttgacaggcgatagc
gtgagtgacgcaccgctcaacgttgttttcaataaaagcaaagggaaagtctatttcttt
aactccccgctggcaacgattcatcaggccaacgccgaatcctgggttgatgttccgctt
ggtgaaaacgttgagctacgtgtcctgattcaggactcaattgctattttttacattaac
aacaaagcggcattcagtacccgtatgtattccatgcctgagaagccatggagtatcagc
ctgcctcaaaacgataattttcacgcaatattgaaaataaaagaaatgatttaa

DBGET integrated database retrieval system