KEGG   Yersinia kristensenii: CH54_3514Help
Entry
CH54_3514         CDS       T03609                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ykr  Yersinia kristensenii
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ykr03016]
    CH54_3514
Enzymes [BR:ykr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CH54_3514
Transfer RNA biogenesis [BR:ykr03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CH54_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJJ34740
UniProt: A0A0T9PSJ5
Position
3829992..3830765
Genome map
AA seq 257 aa AA seqDB search
MLEILYQDEHIVAVNKPAGWLVHRSWLDSNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSDVARALSLQFEQHQIQKTYHAVVRGYVLEDGTIDYEMTEELDKIADKFARPDK
APQPSVTHYHALAQVEVPIAIGRYDTARFSLMELKPETGRKHQLRRHMAHIRHPIIGDST
HGDLRQNRGIAEHFDCSRLMLHASHLHLNHPVTGEPLNLTARWDDSWQQLMSHFGWRGIT
PHLERVEFPATAGQDSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatactttatcaagatgaacatatagttgcggtcaataaaccggctggctgg
cttgtccaccgcagttggttggatagcaacgaaactgtatttgtaatgcaaacagtacgc
gaccagattggccagcatgtttataccgtccatcgactggatcgcccgacatcaggtgtg
ttgctgatggcgctgtccagtgatgtggcccgtgccctttcattacaatttgagcagcat
caaattcagaaaacatatcatgcggttgtacgtggatatgtactggaagatggcacgatt
gattacgagatgaccgaagagttagacaaaattgcggataaatttgcccggccagataaa
gccccgcagccttcggttacccattatcacgcactggctcaagtggaagttcccattgcc
attgggcgctatgacactgcgcgctttagtttaatggaattaaagccagaaacagggcgt
aaacaccagctacggcggcatatggcgcacattcgccaccctatcatcggtgacagcacc
catggcgatttacgccaaaatcgtggaattgctgagcattttgattgttcacggctcatg
cttcatgccagccatttgcatctgaatcaccctgtcaccggagagccactcaatttgacc
gcgcgttgggatgattcctggcaacagctgatgtcacattttggctggcggggtattacc
cctcatcttgaaagggttgagtttccagcaactgcaggtcaggatagtgcgtaa

DBGET integrated database retrieval system