KEGG   Yersinia kristensenii: CH54_462Help
Entry
CH54_462          CDS       T03609                                 

Definition
(GenBank) formate--tetrahydrofolate ligase family protein
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00670  One carbon pool by folate
ykr01100  Metabolic pathways
ykr01120  Microbial metabolism in diverse environments
ykr01200  Carbon metabolism
Module
ykr_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CH54_462
Enzymes [BR:ykr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CH54_462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Peptidase_M36
Motif
Other DBs
NCBI-ProteinID: AJJ34123
UniProt: A0A0T9P082
Position
496091..497848
Genome map
AA seq 585 aa AA seqDB search
MTPKLPTTANDLAPLSDANPDAHLRPIQHIAQQLGLTAEDLIPYGHHMAKVDISALRPGG
PQGKLILVSSITPTPLGEGKTVTTIGLSQGINQLGHRGVACIRQPSLGPVFGVKGGAAGG
GAAQVLPMEKLNLHLTGDIHAISAAHNLAAAALDARLYHEQRLGQAFSQQTGMPLLNIDV
QQILWPRVVDHNDRALRHIRVGMGGGTHGVERPDHVEITAASELMAILALSESLHDMRQR
IGRIILAHSTAGHPITADDLGVAGAMTALMKETIHPTLMQTSEQTPVLIHAGPFANIAHG
NSSVLADRLGLQLAEYVVTEAGFGSDMGMEKFFNIKYRQSGIAPSCVVLVATLRSLKANS
GVFDIKPGQPLPADILNINIPLLSQGCANLKWHIQHAKSYGLPVVVAVNRFPDDSAEELA
FLSDYALSSGAVACEISEAFAKGGLGTTALAQQVINACAHAPEPVLPYPDSASLEQKIAV
LAQSYGARDITFTPQARQQLAAITAAGFAHLPLCMAKTPLSISADARLKNVPRDFVLPIT
ACAVSAGAGFVRIYAGDIMTMPGLGTQPAYYHIDIDDEGCIRGLS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaaactaccgacgaccgccaatgatctcgccccgctatctgatgccaatcct
gatgcccatttgcgccctatccagcatattgctcaacaattaggcttgaccgcagaggat
ttaatcccgtatgggcatcatatggcgaaagtcgatatcagcgcattacgccccggtggc
ccacagggtaaactgattctggtttccagcattactcctacaccgctgggagaaggtaaa
accgtcacgacgattggattaagtcagggaatcaaccagttaggtcatcggggggtcgct
tgtatccgtcaacctagccttggcccggtttttggtgttaaaggcggcgcagcaggcggc
ggagcggcccaagtcttgcccatggagaaactgaacctgcatttgacgggggatatccat
gccatcagtgccgcgcataatctggcggcggcggcgctggatgcgcggttatatcatgaa
cagcgtctagggcaggcttttagtcaacaaaccgggatgccactactcaatattgatgtc
caacaaattctctggccacgggtggttgatcataatgatcgggcgctgcggcacatccga
gtgggcatgggcggtgggactcacggagtggaacggcccgaccatgtggaaattactgcc
gcatcagaactgatggcgattttagcgctgtccgaaagtttgcatgatatgcgccaacgt
attggccggattattttagcccacagcaccgccgggcaccctattactgccgatgatttg
ggcgtggccggtgccatgaccgcgctgatgaaagaaactatccacccaactctgatgcaa
accagtgagcaaacaccggtgctgatccacgcggggccatttgccaatattgcacatggg
aactcctcagtgctggccgaccgtctgggattgcagttagctgagtatgtggtgactgaa
gccggttttggctcggatatgggcatggagaaattctttaatattaagtatcgccaatcc
ggcattgccccgtcctgtgtcgtcttggtcgccacattgcgtagcctgaaagctaatagc
ggtgtttttgacatcaaaccgggccaacccctacccgctgacattctcaatatcaatatc
ccgttattgagccaaggttgcgccaatctaaaatggcatattcagcatgctaaaagctat
ggtttaccggtggtggtggcggtcaatcgcttccctgatgacagtgccgaagaactggcg
tttttgagcgactatgcgctatcctccggcgcagttgcctgcgaaatcagtgaagcgttt
gccaaaggcggcctcgggacgaccgctctggcgcagcaagttatcaatgcctgtgctcat
gcccctgagcctgttctgccttatcctgatagcgcctcactggagcaaaaaatagcggtt
ttggcccaaagttatggtgcccgcgacatcacctttaccccgcaagcacgccagcaactt
gcggccatcacggcggcaggttttgctcatttacccctgtgtatggccaaaacgccactt
tctatcagcgccgatgcccgtttgaagaatgttccacgggattttgtgttgcccatcacc
gcctgtgcggtgtcagccggtgccggatttgtccgcatttatgcgggggatatcatgaca
atgccaggactgggaactcagcccgcgtattatcatattgatatagatgacgaggggtgt
attcgcgggttaagctag

DBGET integrated database retrieval system