KEGG   Yarrowia lipolytica: YALI0A00132gHelp
Entry
YALI0A00132g      CDS       T01033                                 

Definition
(RefSeq) YALI0A00132p
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
yli  Yarrowia lipolytica
Pathway
yli03040  Spliceosome
yli04141  Protein processing in endoplasmic reticulum
yli04144  Endocytosis
yli04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:yli00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YALI0A00132g
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0A00132g
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YALI0A00132g
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YALI0A00132g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:yli01009]
    YALI0A00132g
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:yli03041]
    YALI0A00132g
   03009 Ribosome biogenesis [BR:yli03009]
    YALI0A00132g
   03110 Chaperones and folding catalysts [BR:yli03110]
    YALI0A00132g
   04131 Membrane trafficking [BR:yli04131]
    YALI0A00132g
   03051 Proteasome [BR:yli03051]
    YALI0A00132g
   03029 Mitochondrial biogenesis [BR:yli03029]
    YALI0A00132g
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yli04147]
    YALI0A00132g
Protein phosphatases and associated proteins [BR:yli01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     YALI0A00132g
Spliceosome [BR:yli03041]
 Complex B
  Other components
   Prp19 complex
    YALI0A00132g
 Complex C
   Prp19-CDC5 complex
    YALI0A00132g
Ribosome biogenesis [BR:yli03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YALI0A00132g
Chaperones and folding catalysts [BR:yli03110]
 Heat shock proteins
  HSP70 / DNAK
   YALI0A00132g
Membrane trafficking [BR:yli04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    YALI0A00132g
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    YALI0A00132g
Proteasome [BR:yli03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    YALI0A00132g
Mitochondrial biogenesis [BR:yli03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    YALI0A00132g
Exosome [BR:yli04147]
 Exosomal proteins
  Proteins found in most exosomes
   YALI0A00132g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl ATP-synt_DE
Motif
Other DBs
NCBI-GeneID: 2906265
NCBI-ProteinID: XP_499604
UniProt: Q6CIA7
Position
A:7045..8880
Genome map
AA seq 611 aa AA seqDB search
MSEGTFAGAVGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFVAFTEEERLIGDAAKNQ
AALNPVNTVFDAKRLIGRRFDDESVQKDIQTWPFKVVDNAGAPLIEVDYLGEKKTFSPQE
ISSMVLTKMKEIAEAKLGQAVDKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLGAGKQEAERHVLIFDLGGGTFDVSLLSIQGGVFTVKATAGDTHLGGQDFDTNL
LEHFKAEFKRKTGHDISADPRALRRLRSACERAKRTLSSVTQTTVEVDSLFEGEDFSANI
TRARFEDINAALFKSTLEPVEKVLKDSKIDKSKVNEVVLVGGSTRIPKVQKMLSDFFDGK
ALEKSINPDEAVAYGAAVQGAILTGQAVGEDTEDLLLLDVVPLSLGVAMEGNIFAPVVPR
NTTVPTLKRRTFTTVGDHQTTVQFPVYQGERVNCSENTLLGEFDLKNIPPMKAGEPVLEA
IFEVDANGILKVTAVEKSTGRSANITISNSVGKLSSEDIEKMISDAEKFKSQDEAFSKRH
ENKQKLESYISTIEASITDLDSKFKRGAKDKIETALSDAMSALEIDDASADDYRKAELAL
KRVVTKAMATR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggaacttttgctggagctgtcggtatcgatcttggaaccacctactcgtgt
gttgccacctacgactctgctgtcgagatcattgccaacgagcagggaaaccgagttacc
ccctctttcgttgccttcactgaggaggagcgactgatcggagatgccgccaagaaccag
gccgccctcaaccccgtcaacactgtctttgacgccaagcgactcattggtcgacgattc
gacgacgagtctgtccagaaggatatccagacctggcccttcaaggttgtcgacaacgcc
ggtgcccccctcatcgaggtcgactaccttggcgagaagaagaccttctctccccaggag
atctcctctatggttctcaccaagatgaaggagattgctgaggccaagctcggccaggct
gttgacaaggctgttgtcaccgtccccgcttacttcaacgacgcccagcgacaggccacc
aaggatgctggtgccattgctggtctcaacgttctgcgaatcatcaacgagcctaccgct
gctgccattgcctacggtctcggtgccggtaagcaggaggctgagcgacacgttctcatc
ttcgatcttggaggaggaactttcgatgtctctctgctttccatccagggcggtgttttc
accgtcaaggccaccgctggtgacacccatcttggtggacaggatttcgacaccaacctc
cttgagcacttcaaggctgagttcaagcgaaagaccggccacgacatctctgctgacccc
cgagctctgcgacgactgcgatccgcctgcgagcgagccaagcgaactctgtcttccgtc
acccagaccaccgttgaggtcgactctctcttcgagggtgaggacttctccgccaacatc
acccgagctcgattcgaggacatcaacgctgccctcttcaagtctaccctcgagcccgtc
gagaaggtcctcaaggactccaagatcgacaagtccaaggtcaacgaggttgtccttgtc
ggaggttctacccgaatccccaaggtccagaagatgctctccgacttcttcgacggtaag
gccctcgagaagtccatcaaccccgatgaggctgttgcctacggtgccgctgtccagggt
gctatcctgaccggccaggccgtcggtgaggacaccgaggatctgctgctgctcgatgtt
gttcccctttctcttggtgtcgccatggagggtaacatcttcgcccccgtcgttccccga
aacaccaccgtccctaccctcaagcgacgaaccttcaccaccgtcggtgaccaccagacc
accgtccagttccccgtttaccagggagagcgagtcaactgctccgagaacaccctgctc
ggtgagttcgacctcaagaacatcccccccatgaaggccggcgagcccgttctggaggcc
atcttcgaggttgacgccaacggtatcctcaaggtcaccgccgttgagaagtccaccggc
cgatccgccaacatcaccatctccaactccgtcggaaagctgtcttccgaggacattgag
aagatgatctccgacgccgagaagttcaagtctcaggatgaggccttctccaagcgacac
gagaacaagcagaagctcgagtcttacatctccaccatcgaggcctccatcaccgacctt
gactccaagttcaagcgaggtgctaaggacaagatcgagactgctctctccgatgccatg
tccgcccttgagattgatgacgcctctgccgacgactaccgaaaggccgagctcgccctt
aagcgagttgtcaccaaggccatggctacccgataa

DBGET integrated database retrieval system