KEGG   Yarrowia lipolytica: YALI0A06908gHelp
Entry
YALI0A06908g      CDS       T01033                                 

Definition
(RefSeq) YALI0A06908p
  KO
K15529  ADP-ribose 1''-phosphate phosphatase [EC:3.1.3.84]
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YALI0A06908g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.84  ADP-ribose 1''-phosphate phosphatase
     YALI0A06908g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 2906499
NCBI-ProteinID: XP_499826
UniProt: Q6CHN5
Position
A:672539..673048
Genome map
AA seq 169 aa AA seqDB search
MGYRLSALTYVQGDLFEESPRPAVLAHACNCLGSWGSGVAAGFKQKFPGAFVEYKRHCDK
YSDDNSALLGTCQLIETHDAQTGELVYVACLFTSVRFGARVDGPEQIVKQTKLAMQDLQK
QLAKMSGPIDGNSTVHMPKINAGLFRVPWRDTEKVLEEVGQPCTVYVID
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgggatacagactttcggcgctgacatatgtgcagggcgacctgtttgaggagtcgccg
cgaccggccgtacttgcacatgcgtgcaactgtctgggatcgtggggctccggagtggca
gccggcttcaagcaaaagttccccggggcctttgtggagtacaagcgacactgcgacaaa
tactcggacgataactcggcgcttctgggcacctgccagctgattgagacgcacgacgcg
cagaccggcgaattggtttatgtggcttgtctgtttacttctgtgcgttttggagcgcgt
gtggacggccccgagcagattgtgaaacagactaaactagccatgcaggatctacagaag
cagttggcgaaaatgtcaggtccaattgacggcaactcgaccgtccacatgcccaagatc
aacgctgggttgttccgagtgccctggagagacacggaaaaggtgctggaggaggttggc
cagccctgcactgtttacgtcattgattag

DBGET integrated database retrieval system