KEGG   Yarrowia lipolytica: YALI0A06996gHelp
Entry
YALI0A06996g      CDS       T01033                                 

Definition
(RefSeq) YALI0A06996p
  KO
K06634  cyclin H
Organism
yli  Yarrowia lipolytica
Pathway
yli03022  Basal transcription factors
yli03420  Nucleotide excision repair
Module
yli_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YALI0A06996g
  Replication and repair
   03420 Nucleotide excision repair
    YALI0A06996g
Transcription machinery [BR:yli03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YALI0A06996g
DNA repair and recombination proteins [BR:yli03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YALI0A06996g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 2906117
NCBI-ProteinID: XP_499830
UniProt: Q6CHN1
Position
A:complement(678527..679621)
Genome map
AA seq 364 aa AA seqDB search
MTSATASSKATKTVTDDDIYRQSSQFKKWSFTPTQLAARRLQTNTNGREFVKQSFLAADL
DPAMAKILSVDEELTMVNYMCSQSEGIAQVLNLPSKVKATAVLFFKKFFLINSVMVYSDP
VKVLHTCFFLATKAENHFFSINQFCKYTGAVAKDVLQLEFVVMQSMLFSLSAQSAYTPLH
GFYLDIQTSLPHVPASTVGSLYDGARKYVSLSFLTDANFLFTPPQISLAAMMCTNSQITE
QYLRVKMSDPAQFNLTTKLVQECVDMLQKVDKPTKEYVQEIGKKLRSCDVEKTKARLLKR
KLKEQGEGDAKKQKLDSETPQPPDMSNSASTEPASAEASASASASTTDASAPASASASAS
TEQS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgctacagcatcatccaaggccacaaaaacggtcacggacgacgatatttac
cggcaatcgtcgcagttcaaaaaatggtcgtttacgccgacgcaactggcagctagacgg
cttcaaaccaacaccaacggccgcgagtttgtcaaacagtcgtttctagcggcggatctc
gatcccgccatggccaaaatcctctctgttgacgaggaacttaccatggtcaattacatg
tgttctcagagcgagggaattgcccaagttctcaatctaccttctaaagtgaaggcaaca
gctgtactcttcttcaaaaagtttttcctcatcaactccgtcatggtgtacagtgacccc
gtcaaggtcttgcatacgtgtttctttttggccaccaaagccgagaatcacttcttttcc
atcaaccagttctgcaaatacactggagcggtggccaaggacgttttgcaactcgagttt
gtggtgatgcagtcgatgctgttttctttgagcgcccagagcgcatacactcccttgcat
ggcttctatctcgacatccagacgtcgctgccccacgttcctgcctcgacagtcgggtct
ctgtacgatggagccagaaagtacgtgtctctgagctttctaaccgacgcaaatttcctc
tttacccctccgcaaatctcgctcgcggccatgatgtgcacaaatagccagataaccgag
cagtatttgcgagtgaagatgagcgacccagcgcagttcaacctgaccacaaagctggtt
caggagtgcgttgacatgctgcaaaaggtggacaagccgaccaaggagtatgtgcaggag
attggaaagaagctgcggtcgtgtgacgtggagaaaaccaaggcgagattgctgaaacgc
aagcttaaggagcagggagagggcgacgcaaagaagcagaagctggactcggaaactcct
cagcctccagacatgtccaattccgcttctactgagcctgcatccgcagaggcttctgct
tcggcgtctgcatcgacaacagatgcttctgctccggcgtcggcgtctgcgtctgcgtcc
actgaacagtcctaa

DBGET integrated database retrieval system