KEGG   Yarrowia lipolytica: YALI0A15147gHelp
Entry
YALI0A15147g      CDS       T01033                                 

Definition
(RefSeq) YALI0A15147p
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00071  Fatty acid degradation
yli00350  Tyrosine metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0A15147g
  Lipid metabolism
   00071 Fatty acid degradation
    YALI0A15147g
  Amino acid metabolism
   00350 Tyrosine metabolism
    YALI0A15147g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YALI0A15147g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 adh_short AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 2905743
NCBI-ProteinID: XP_500087
UniProt: Q6CGX5
Position
A:1560639..1561685
Genome map
AA seq 348 aa AA seqDB search
MTIPKTQKAIVFETSGGPLEYKDVPVPVPGDHQILVNVKYSGVCHSDLHAWMGDWPLPTK
LPLIGGHEGAGVVVAKGKNVTTFEIGDYAGIKWINQACYTCEFCQEAYEPNCPKAQISGY
TMDGTFQQYALADAVQAAHIPQGTDLSQVAPILCAGVTVYKAIKTSGRKAGEWLAVTGAG
GGLGSLAVQYAKAMGFRVLAIDTTEEKEKMCLELGAEVFVDFAKTDNLVARVQEITGGGP
HGVINVSVSEFAINQSLEYVRSVGTVVLVGLPAGAVCKSPIFSQVARAITIKGSPVGNRA
DTQEALSFFTRGLVHSPIHVVGLSELQKVFTLMEEGKIAGRYVVDTSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccccaagacccagaaagccattgtgttcgaaacctctggaggtcccctggag
tacaaggacgtgcctgtgcccgtgcccggcgaccatcagattctcgtcaacgtcaagtac
tcgggagtttgccactctgacctccacgcctggatgggagactggcctctacccaccaag
ctccctcttatcggcggccacgaaggagccggcgtcgtggtggccaagggaaaaaacgtg
accacgttcgaaattggagactacgccggaatcaagtggatcaaccaggcgtgctacacg
tgcgagttctgccaggaggcctacgagcccaactgtcccaaggcccagatctcgggatac
acaatggacggaaccttccagcagtatgcacttgcagatgctgtgcaggcagcccacatt
ccccagggcacagacctttctcaggtggctcctattctgtgtgccggagtgactgtttac
aaggccatcaagacctctggacgaaaggcaggagaatggttggccgtgacaggtgcagga
ggaggactcggatcgctggcggtgcagtacgccaaggccatgggtttccgagtgctggcc
atcgacaccaccgaggagaaggagaagatgtgtctggaactgggagcagaggtctttgtg
gactttgccaagactgacaatctggtggcacgagttcaggagattactggaggtggccct
catggagtcatcaacgtttctgtgtccgagtttgccatcaaccagtctctcgagtacgtt
cggtccgttggaactgttgttctggtgggtctgcctgctggagctgtgtgcaagtcgccc
atcttctcgcaggtggcccgggctattaccatcaagggctctcctgtgggtaaccgagcc
gacacccaggaggctctgtcattctttacccgaggattggttcactcgcctattcatgtg
gtcggactgtctgagctgcagaaggtgtttaccttgatggaggagggaaagattgcgggt
cggtatgttgtcgataccagcaagtaa

DBGET integrated database retrieval system