KEGG   Yarrowia lipolytica: YALI0B02090g
Entry
YALI0B02090g      CDS       T01033                                 

Definition
(RefSeq) YALI0B02090p
Organism
yli  Yarrowia lipolytica
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 2906647
NCBI-ProteinID: XP_500411
UniProt: Q6CG01
Position
B:complement(302335..304983)
AA seq 882 aa
MKLNVIDAAKHAKDLWMKQDPRDEEDESDVQAEVVEIEEQLIEWMANKLGIPPSDKDGGY
PLEVHFMAEKLAEMPIDKALELVKTNYAYHDHDNNFRHEYRMEVKSVLEAFGEGEDPEKE
DPDNLILLRYWAVIFHWWSPYPEVRSVTDPYDETDTTVETWRVWVLGTIWVAISAFVNQF
FSVRLPAISLDASVCQLLLYPCGRFLQYVLPDWGFSFRGRRYTLNPGVWSQKEQLLATIM
VSCAAGTPYITSNIITQALPSFYNQDWAANYGYQFVFMLVTQMMGFGMAGLLKRVAVYPV
KAMWPSLLPTLAVNKALLAPNRKESINGWKISRYTFFMIMFVVSFLYFWVPNYLMNFLQT
FNWMTWIAPNNADLAIVTGSIGGLGFNPIPTFDWNQATANLAPITLPLYTSITGFCGSLF
GGLVILALYYSNNSWTGYIPINSNRLFDNKGKAFNVTRILTNYRFDREKYLAYSTPYYSA
GNLVLYSAFFAVYTFSFVYTTLMDWRAMRDAIVDTAKAIRYIHRSNYHGRVDPYSRYMKK
HKEVPDWWFYLTMLIMFVLAIVLVEVWPVDTPVWSIVFVMGLVAVFIVPFTVFVSYTATS
LSLNVLAELIIGYALPGRFMALNLIKALSVQIAQQAENYTSDQKLTHYAHLPPRSIFWLQ
IWATLVNGVVCLGVIQFQLGLENLCDADNKLKFTCPSETTFFTASVAWGVIGPKKMFNKY
PVMKWMFLFGAGAGLFFYVVQVTLPKFLAKWWPKHAEKIDYYRRKCLYFNPLIFVVGIID
GWAPYNLTYKVGGLYLAILFNGYIKGRYLAWWRKYAYVMEAAIVTGIALSGIIIFFSVQY
NPKDLDWWGNNVIGDGVDGSGIPPNKKIPEDPGFFGPDSSQW
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgaaactcaacgttatcgacgctgcaaaacatgccaaagatctgtggatgaaacaggat
cctcgagatgaggaggacgagtctgatgttcaggccgaggttgtggagatcgaagaacaa
ctcattgaatggatggccaacaaactcggtattcctccgtccgacaaagatggcggatat
cccctagaggttcatttcatggccgagaaactggctgaaatgcccattgacaaggctctg
gaactcgtcaagaccaactacgcctaccacgatcatgacaacaactttcgacatgagtac
cgtatggaggtcaagagcgtgctggaggcctttggagagggtgaggatcctgagaaagaa
gaccccgacaacctcattctgctgcgctactgggcagtcatcttccactggtggagtccc
tatcctgaagttcgttccgtcactgatccctacgacgaaacagacactacagttgagaca
tggagagtgtgggttctgggaaccatctgggttgcaatttctgcctttgtcaaccagttc
ttttccgtccgtctgcccgccatcagcctcgacgcctcggtctgccaactgctcctctac
ccctgtggacgattcctgcagtatgtgctacctgactggggctttagtttcagaggaaga
cgatacactctgaatccgggagtctggagccagaaagaacaactcctggcaactatcatg
gtctcgtgtgcggctggaacgccttatatcacctccaacattatcacccaggctctaccg
tccttctacaaccaagactgggccgccaactacggctaccagtttgttttcatgctggtg
acgcaaatgatgggctttggaatggccggtctgttgaaacgagtggctgtgtaccccgtc
aaagccatgtggccctccttgctgcctaccctggcggtgaacaaagctctgctggctcca
aacagaaaagagagcatcaacggctggaagatctcccgatacaccttcttcatgatcatg
tttgtggtatccttcctctacttctgggtgcccaactacctcatgaactttttgcagacc
ttcaactggatgacctggatcgctccaaacaacgcggacctagctatcgtcacgggctcc
atcggcggactcggattcaaccccattccaacctttgactggaaccaggccaccgccaat
ctcgctcccatcaccctacctctgtacacctccatcacgggcttctgcggctccctcttt
ggaggcctcgtcatcctggctctctactattctaacaactcatggacgggctacatcccc
atcaactccaaccggctttttgacaacaagggcaaggcgttcaacgtgacccgaattctg
acaaattatagatttgacagagaaaagtacctcgcctactccacgccgtattactcggca
ggaaacctcgttctctactcggccttcttcgcagtctacaccttttcgttcgtgtacacg
acgctcatggactggagagccatgagagacgccattgtggataccgccaaggcaatcagg
tacatccaccgaagtaactaccacggaagagtcgacccttactctcggtacatgaagaaa
cataaggaggtccccgactggtggttctacctcaccatgctcatcatgtttgttctggcc
attgttctggtggaagtgtggcccgtagatacaccagtgtggagtattgtgtttgtcatg
ggcttggtggctgttttcattgtgcccttcactgtgtttgtgtcgtacacagccacctct
ctgtccctcaacgttctggccgaactcatcattggctacgcccttccgggtcggttcatg
gcgttgaatctcatcaaagccctgtccgtgcaaatcgcccagcaagctgagaactacacg
tctgatcagaaactgacccattatgcccatctgcctccccgatccatcttctggttgcaa
atctgggccactctggtcaatggagtggtgtgtctgggtgtgattcagttccagctaggt
ctggagaacctctgtgacgcagacaacaagctcaagttcacatgtccgtcggaaaccacc
ttcttcaccgcctcggtcgcatggggagtcattggccccaagaagatgttcaacaagtat
cccgtcatgaaatggatgttcttgtttggagctggagccggactcttcttctatgttgtc
caagtcacgcttccaaagttcttggccaaatggtggcccaaacacgccgagaagatcgac
tactaccgacgaaagtgtctgtacttcaacccgctcatttttgtggtcggtatcattgac
ggttgggccccgtacaacctgacctataaggtcggaggactgtatcttgccatcctgttc
aacggatacatcaagggccgatatcttgcgtggtggcgaaagtacgcctacgtcatggag
gcggctattgtcacaggaattgccctgtctggtatcatcatctttttttcggtgcagtac
aacccgaaagatctggattggtggggcaacaatgtgattggagatggagtagatggatcg
ggaattccgccgaacaagaagatccccgaggacccgggattctttggaccggactcgtct
caatggtag

DBGET integrated database retrieval system