KEGG   Yarrowia lipolytica: YALI0B04642g
Entry
YALI0B04642g      CDS       T01033                                 

Definition
(RefSeq) YALI0B04642p
Organism
yli  Yarrowia lipolytica
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 2907049
NCBI-ProteinID: XP_500504
UniProt: Q6CFQ8
Position
B:630362..633022
AA seq 886 aa
MTILSATVEKAKKAKEIWLQDDPRDQDDDDSQVQAEVVEVDDSLIEWIAMKLGIPPSDFD
GSYPREVHFMAEKLAEMTLEKALNIVKVNFEYHDHDNNFRHEYRVEINGLKEAFGSGEDP
EKEDPENILLVRYWATIFHWWSPYPEVRSVTDPYDETETTVETWRVWVLGTIWVAIAAFV
NQFFSVRLPAISLGSGVCQLLLYPCGRFLQYTLPDWGFTFRGKRYTLNPGVWSQKEQLLA
TIMIGCAAGTPYVTSNIITQALPSFYNQDWARGFGYQFVLTLVTQMMGFGLAGLLKRVAV
YPVKAMWPSLLPTLAVNKALLAPNRKESINGWKISRYTFFMIIFAFSFLYFWVPNYLMNF
LQTFNWMTWIAPGNKDLAVVTGSVAGLGFNPIPTFDWNQAVAGIAPITLPLYTSVTGFVG
TFFGGLVILAVYYTNNSWTAHIPINSNRLFDNKGKSFNVTRILTDYKFDKEKFLNYSTPY
YSAGNLVLYSAFFSIYTFSFVYTILMDWRAMRDAIVETAKALRYIHRSNYHGRVDPFSRY
MRRHKEVPDWWFYLTLLIMFVLAIVLVEVWPVDTPVWSIVFVMGLVAVFIIPFTVFVSYT
ATSLSLNVLSELIIGYALPGRFMALNLIKALSVQIAEQAENYTSDQKLTHYAHLPPRSIF
WLQIWATLVNIFVCLGVIQFQLGLDKICDADNRLKFTCPSETTFFTASIAWGVIGPKKMF
DKYPVMKWMFLFGACAGLFFWFVQVMVPYYMAKKWPKYSEKIHYYRRKCLYFNPLIFVVG
MLAWAPQNLTYKVGGLYLAILFNGYIKSRYLSWWRKYAYVLEAAMDTGIALSGIIIFFSV
QYHPKDLEWWGNDVIYDGMDGGGIPLPPHVPIPEDPGYFGPPPSQW
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgacaatcctttctgccacggtcgaaaaggccaaaaaggccaaggagatctggcttcag
gacgatccccgcgaccaagacgatgatgactcgcaagttcaggccgaggtggttgaggtc
gacgactcgctaattgagtggattgccatgaaactcggcattcccccttctgatttcgat
gggagttatcctcgagaagtccatttcatggccgagaagctggcggagatgactctggag
aaggcgttgaacatcgtcaaggtcaactttgagtaccatgaccacgataacaactttcgg
cacgagtaccgggtggaaatcaatggtctgaaagaagcgtttgggtctggcgaggatcca
gagaaggaagatcccgaaaacatcttgctggtacgttattgggctaccatctttcattgg
tggagcccctaccccgaggttcgatcggtgacagacccctatgacgagaccgaaaccacc
gtggagacttggagagtgtgggttttgggaacaatttgggtagccattgctgcttttgtt
aaccagttcttctctgttcgtcttcctgccatttcgctgggctcgggggtatgtcaactc
ttgttgtacccttgcggacgcttcctacagtacactcttcctgactgggggttcaccttc
agaggaaaacggtacacactgaaccccggagtttggagtcagaaagaacagcttctggcc
accatcatgatcggatgtgcagcgggaaccccctacgtcacctcaaacattatcacccag
gcccttccctccttctacaaccaggactgggccagaggcttcggctaccagtttgtgttg
actctggtgacccagatgatgggattcggacttgctggactactcaagagagtcgctgtc
tacccggtcaaggccatgtggccctcgcttctgcccactcttgctgtcaacaaggctctt
ctggcccccaacagaaaagaaagtatcaatggatggaagatctcacgatacaccttcttc
atgattattttcgccttctcgtttctgtacttctgggtgcccaactacctcatgaacttc
ctgcagacattcaactggatgacgtggatcgcgccaggcaacaaagatctcgccgttgtc
actggatcggttgcggggctcggtttcaatcccattcccaccttcgattggaatcaggcc
gtcgctggaatcgcgcctatcacccttcctctgtacacttctgtcactggctttgtgggc
accttctttggaggtttggttatcctggctgtctactacaccaacaactcgtggaccgcc
cacatccccatcaactccaatcgtctgtttgacaacaagggcaagtctttcaatgtgacc
agaattctcaccgactacaaattcgacaaagaaaagtttctcaactactccaccccctac
tactcggccggaaacctcgttctttactcggcctttttctccatctacacgttctcgttt
gtgtacaccattctcatggactggagagcaatgcgagatgccatcgtggagactgccaag
gccctcagatacattcaccggtccaattaccatggaagagtcgaccctttctctcgatat
atgcgacgacataaagaggtccccgactggtggttctatctcactctgctcatcatgttt
gtcctggcgattgttctagtggaagtgtggccagtagatactcctgtgtggagtattgtc
tttgtgatgggcttggtggctgttttcatcattccctttacagtttttgtctcctacacc
gccacctctctgtcactcaatgtgctttcagagctcattattggatatgccctccctgga
cggttcatggcgcttaacctcatcaaggctctgtcagtacagattgctgagcaggccgag
aactacacgtccgaccagaaactgacccactacgcccaccttcccccccgatccatcttc
tggctccagatctgggctactcttgtcaacatttttgtttgtctgggagtgatccagttt
cagctgggtttggacaagatttgtgacgccgacaaccgactcaagttcacctgtccgtcg
gaaaccaccttcttcacggcctccatcgcctggggagtcattggccccaaaaagatgttc
gacaagtatcctgtcatgaagtggatgttcctttttggagcctgcgctggcctctttttc
tggtttgttcaggtcatggtgccttactatatggccaagaaatggcccaaatactcggaa
aaaatccactactaccgacgaaagtgtctctacttcaacccgctcattttcgtcgtgggt
atgctagcctgggcgcctcagaacctcacttataaggtgggcgggctctacctggccatt
ctgttcaatggctacatcaagtcacgatacctgtcctggtggagaaagtacgcctacgtt
ttggaggcggctatggacacgggaatcgctctgtcgggaatcatcatcttcttctcggtc
cagtatcatccaaaagatttggaatggtggggaaatgacgtgatttacgacggaatggat
ggaggaggaattcccttgcctccacatgtgccaattcccgaagacccggggtattttgga
ccgcctccgtctcagtggtaa

DBGET integrated database retrieval system