KEGG   Yarrowia lipolytica: YALI0B05368g
Entry
YALI0B05368g      CDS       T01033                                 

Definition
(RefSeq) YALI0B05368p
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
yli  Yarrowia lipolytica
Pathway
yli00240  Pyrimidine metabolism
yli01100  Metabolic pathways
yli01240  Biosynthesis of cofactors
Module
yli_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YALI0B05368g
Enzymes [BR:yli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     YALI0B05368g
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-GeneID: 2907099
NCBI-ProteinID: XP_500526
UniProt: Q6CFN6
Position
B:complement(join(731252..732945,733006..733030))
AA seq 572 aa
MKYVVVSGGVISGIGKGVLASSTGLLLKTKGLKVTSIKIDPYMNIDAGTMSPLEHGEVFV
LNDGGEADLDLGNYERYINVTLTRDHNITTGKIYQHVIERERRGEYLGKTVQIVPHLTNA
IQDWIERVAKIPVDDTDEEPDVCIIELGGTVGDIESAPFVEALRQFQFRVGPDNFALIHV
SLVPFIHGEQKTKPTQAAIKDLRSLGLTPDIIACRCQAELEASTINKIAMFCNLGPKQVL
DVYDVNSTYHVPLLLQKQGIIDLLTRKLALDQISISGRFRDRGNGLLGKWRQLTTQHDRS
FETVSIAMVGKYTHLQDSYLSVIKALEHSAMKCHRRLEILWIESSDLESESDEKAKYHQA
WTKLCRADGILVPGGFGTRGTEGMIKAANWARENKKPYLGICLGLQIAVIEFARNVCELD
GANSEELDPETETKAVVFMPEGDREKLGGTMRLGARTTVFQPGSEKSKIRKLYGSADSVE
ERHRHRYEVNPELVETFEAAGLKFVGRDTAGQRMQVLELDNHPYYVATQYHPEYLSRVLD
PSRPILGLVAAACGKLDEITKGQSAEIASGEF
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgaaatacgtggttgtctctggaggtgtcatttccggcattggtaagggtgtcttggcc
tcttccactggccttttgctcaagaccaagggtctcaaggtcacatccatcaaaattgat
ccctacatgaacattgacgccggaacgatgtctcctctggagcacggtgaggtttttgtt
ctcaacgatggtggtgaagctgatttggatctcggtaactacgagcggtacatcaacgtc
acccttactcgggaccacaacattaccaccggtaagatctaccagcacgtgattgagcga
gagagacgaggtgagtatcttggaaagactgtgcagattgttcctcatctcaccaacgcc
attcaagactggattgagcgtgtggccaagattcccgtcgatgacactgacgaggagcct
gacgtctgcatcatcgaactcggaggtactgttggtgacattgagtccgctccttttgtt
gaggctcttcggcagttccagttccgtgtcggtcctgacaatttcgcactcatccacgtg
tctctcgtgcccttcattcacggtgagcagaaaaccaagcctacccaggccgccatcaag
gacttgcgatcgctgggtctgacccccgacattattgcatgccgatgtcaggctgagctt
gaggctagtacaatcaacaagattgccatgttctgcaaccttggtcccaagcaggtgctt
gatgtgtacgacgtcaactctacctaccatgttcctcttcttctgcagaagcaaggaatt
atcgacttgctcacccgaaaattggctctcgaccaaatctcgatctcaggaagattccga
gatcgtggtaatggtctgctcggaaaatggcgacagctaactactcagcatgaccggtcg
ttcgagactgtttccattgcaatggttggaaagtacacacatcttcaggattcttaccta
tctgtcattaaggccctggagcactccgccatgaagtgccaccgaagactcgagattctg
tggattgagtcgtccgacttggagtctgagtcagatgagaaggcaaagtaccaccaggct
tggactaagttgtgccgggcagatggtatccttgttcctggtggttttggcactcgagga
actgagggtatgatcaaggccgcaaactgggcccgagaaaacaagaagccttaccttggt
atctgtctgggtcttcagattgccgtcatcgagtttgcacgaaatgtctgtgagcttgat
ggggccaactcggaagagctggaccctgagaccgagaccaaggctgtggttttcatgcct
gagggagaccgagaaaagctcggaggtactatgcgacttggcgctcgaactactgtattc
cagcccggctctgagaagtctaagattcgaaagctgtacggctctgccgacagtgtcgag
gagcgacaccgacaccgatacgaggttaaccctgagctggtggagacctttgaggctgcc
ggtctcaagtttgttggcagagacaccgctggccaacgaatgcaggtgcttgagcttgat
aaccacccttactacgtggctactcagtaccaccccgagtacctttcccgagtgctggat
ccttctagacctatcttgggtctcgtggctgctgcctgtggtaagcttgatgagatcacc
aagggccagtctgccgaaattgccagcggtgagttttaa

DBGET integrated database retrieval system