KEGG   Yarrowia lipolytica: YALI0B13970gHelp
Entry
YALI0B13970g      CDS       T01033                                 

Definition
(RefSeq) YALI0B13970p
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yli  Yarrowia lipolytica
Pathway
yli00564  Glycerophospholipid metabolism
yli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YALI0B13970g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YALI0B13970g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored GIDA Pyr_redox NAD_binding_8 3HCDH_N Pyr_redox_3 Thi4 HI0933_like Lycopene_cycl GMC_oxred_N
Motif
Other DBs
NCBI-GeneID: 2907009
NCBI-ProteinID: XP_500862
UniProt: Q6CEQ0
Position
B:complement(1870546..1872384)
Genome map
AA seq 612 aa AA seqDB search
MFRTIRKPAWAAAAAVAAAGAGAVALSVPAQAQEELHKKHKFTVPPVAAEPPSRAAQLEK
MKTEEFDLVVVGGGATGSGIALDAVTRGLKVALVERDDFSCGTSSRSTKLIHGGVRYLEK
AVWNLDYNQYELVKEALHERKVFLDIAPHLTFALPIMIPVYTWWQLPYFWMGVKCYDLLA
GRQNLESSYMLSRSRALDAFPMLSDDKLKGAIVYYDGSQNDSRMNVSLIMTAVEKGATIL
NHCEVTELTKGANGQLNGVVAKDTDGNAGSFNIKAKCVVNATGPFTDSLRQMDDKNTKEI
CAPSSGVHIILPGYYSPKKMGLLDPATSDGRVIFFLPWQGNTLAGTTDQPTKITANPIPS
EEDIDFILNEVRHYVEGKVDVRREDVLAAWSGIRPLVRDPHAKNTESLVRNHLITYSESG
LVTIAGGKWTTYRQMAEETVDACIAKFGLKPEISAKAVTRDVKLIGAKDWTPLTYIDLIQ
QEDLDPEVAKHLSENYGSRAFTVASLAEMPTPEPGVIPQSTLTKGKRILYPYPYLDAECK
YSMKYEYATTAIDFLARRTRLAFLNAAAAYEALPEVIEIMAKELQWDEARKEQEFNTGVE
YLYSMGLTPKDK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaccattcgaaaacccgcgtgggctgctgccgccgccgtggcagccgctggc
gctggagccgtcgccctgtctgtgcctgcccaggcccaggaggagctccacaagaagcac
aaattcacagtgccccccgtggccgccgagcccccctctcgagccgcccagctcgagaag
atgaagaccgaggagtttgatctcgtcgttgttggtggaggagctaccggatccggtatc
gccctcgacgctgtcacacgaggcctcaaggttgctctggtcgagcgagacgatttctcc
tgcggaacctcgtcccgatccaccaagctcatccacggaggtgtccgatacctcgagaag
gctgtgtggaacctcgactacaaccagtacgagctggtcaaggaggccctgcacgagcga
aaggtcttcctcgacattgctccccacctcacctttgctctgcccatcatgatccccgtc
tacacctggtggcagcttccctacttctggatgggtgtcaagtgctacgatctgcttgcc
ggccgacagaacctcgagtcctcttacatgctctcccgatcccgtgctctcgatgccttc
cccatgctttccgatgacaagctcaagggcgccattgtctactatgatggctcccagaac
gactctcgaatgaacgtttctcttattatgactgctgttgagaagggtgccaccatcctg
aaccattgcgaggtcaccgagctcaccaagggcgccaatggccagctcaacggtgttgtt
gccaaggatactgacggaaacgctggatccttcaacatcaaggccaagtgtgtcgttaat
gctactggacccttcactgactctctgcgacagatggacgacaagaacaccaaggagatc
tgtgctccttcctccggtgttcacatcattctccccggttactactcccccaagaagatg
ggactccttgaccccgctacttctgacggccgagttatcttcttcctcccctggcaggga
aacacccttgccggtactactgaccagcctaccaagatcactgctaaccctatcccctcc
gaggaggacattgacttcattctcaacgaggtccgacactacgttgagggcaaggttgat
gtgcgacgagaggacgttctggccgcctggtccggaatccgaccccttgtccgggacccc
cacgccaagaacaccgagtctcttgtccgaaaccatctcatcacctactccgagtctggt
cttgtcaccattgctggcggaaagtggaccacttaccgacagatggctgaggagactgtc
gatgcctgcattgccaagttcggtctcaagcctgaaatctccgccaaggccgtcacccga
gacgtcaagctcatcggtgctaaggactggactcctctcacttacattgatctgatccag
caggaggaccttgaccccgaggttgctaagcacctttctgagaactacggatctcgagct
ttcaccgttgcttctcttgctgagatgcccacccccgaacccggtgtgatcccccagtct
actctcacaaagggtaagcgaatcctgtacccctacccctacctcgatgccgagtgcaag
tactctatgaagtacgagtatgccaccaccgccatcgacttccttgctcgacgaactcgt
cttgctttccttaacgccgctgccgcctacgaggctctccctgaggtcattgagatcatg
gccaaggagctccagtgggacgaggctcgaaaggagcaggaattcaacaccggtgtcgag
tacctctactccatgggccttacccccaaggacaaataa

DBGET integrated database retrieval system