KEGG   Yarrowia lipolytica: YALI0B16434g
Entry
YALI0B16434g      CDS       T01033                                 

Definition
(RefSeq) YALI0B16434p
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
yli  Yarrowia lipolytica
Pathway
yli00510  N-Glycan biosynthesis
yli00513  Various types of N-glycan biosynthesis
yli01100  Metabolic pathways
yli04141  Protein processing in endoplasmic reticulum
Module
yli_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YALI0B16434g
   00513 Various types of N-glycan biosynthesis
    YALI0B16434g
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YALI0B16434g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:yli01003]
    YALI0B16434g
Enzymes [BR:yli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     YALI0B16434g
Glycosyltransferases [BR:yli01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   YALI0B16434g
SSDB
Motif
Pfam: STT3
Other DBs
NCBI-GeneID: 2907461
NCBI-ProteinID: XP_500973
UniProt: Q6CED9
Position
B:complement(2162577..2164817)
AA seq 746 aa
MQLSASTVKSINLLLKVSILLTIAGAAVSSRLFSVIRFESIIHEFDPWFNFRASKYLVNN
SYYKFLNWFDDKTWYPLGRVTGGTLYPGLMVTSGVIHKLLRMVALPIDIRNICVMMAPAF
SGLTAYATYLFTSEMKDQSAGLLAAAFIGIAPGYISRSVAGSYDNEAIAIFLLMITFYTW
IKALKMGSAFWGAVCAAFYFYMVAAWGGYVFITNMIPLHVFVLILMGRYNDRIYVAYSTW
YALGTLASMQIPFVGFLPIRSSEHMAALGVFGLVQLAAFANYIKSQVTPKQFKYTVGLSL
VGLIAIAFAGLVGLTVSGVIAPWTGRFYSLWDTGYAKIHIPIIASVSEHQPTAWPAFFFD
TQMLIWLFPAGVYLIFQELRDEHIFVIVYSILGSYFAGVMVRLMLTLTPVICVSAAIAIS
TLLDVYGDFSTKTKGDTVLVPKYQPLGHEKPGEVVEDDEDDETVDKAAKFTLGLVAKGAV
IVSFLFYLGMFVYHCTWVTSNAYSSPSVVLASRMPDGSQHLIDDYREAYYWLRMNTPEDA
RIMSWWDYGYQIGGMADRTTLVDNNTWNNTHIATVGKAMSSSEEVAYPILRQHDVDYVLV
IFGGHLGYSGDDINKFLWMVRIAEGIWPDEIKERNYFTPAGEYKVDDKASEAMKNSLMYK
MSYYRFAEGTQKPDRVRNQWIPPTPIELNTLEEAYTTENWLVRLYKVKDLDNLGRDLKSA
KSFDTGKAKKKGKAAYSEKRAFELRE
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgcagttatcagcctcgacagtcaagtcgatcaacctgctgctcaaggtgagtattctg
ctgacgattgctggcgctgcggtttcgtcgcgtctgttttcggtgattcggtttgagtcc
atcatccacgagtttgacccttggttcaacttccgagcctccaagtatctggtcaacaac
agttactacaagttcctcaactggttcgacgacaagacatggtaccctcttggccgagtc
actggaggtaccctctaccccggtctcatggtcacctctggtgtcatccacaagctgctg
cgaatggtggccctgcccattgacattcgaaacatttgtgtcatgatggcacccgccttc
tcgggcctcacggcctacgccacctacctgttcaccagtgagatgaaggaccagagtgcc
ggtctgttggccgctgccttcatcggtattgcccccggatacatttctcgatctgtcgct
ggatcctacgataacgaggcaattgccattttcctgctcatgatcaccttctacacctgg
atcaaggccctcaagatggggtcagctttctggggtgctgtctgtgctgccttttatttc
tacatggtcgccgcctggggaggatacgtgtttatcactaatatgatccctcttcatgtg
tttgtgctcatcctcatgggccgatacaatgaccgaatctacgtggcctacagcacatgg
tatgcgctgggtacactcgcctccatgcagattccttttgtgggtttcctacccatccgg
tcctctgagcacatggctgctctaggtgtctttggactggttcagctggccgcttttgcc
aactacatcaagagccaggtcacccccaagcagttcaagtacaccgtcggtctgtctctg
gtgggtctcattgctattgccttcgctggcctcgtgggtctcactgtctctggtgtcatt
gctccctggaccggccgattctactccctctgggataccggctacgccaagatccacatt
cccattattgcctctgtctccgagcaccagcctactgcctggcctgctttcttctttgac
acccagatgctcatctggctcttccctgctggtgtctacctcatcttccaggagctgcga
gacgagcacatttttgtcattgtgtactccattctcggttcatactttgccggtgtcatg
gtgcgactcatgctcactctgactcctgtcatctgtgtgtccgctgctattgccatctcc
accctgcttgacgtctacggtgacttctctaccaagactaagggcgacactgttctggtt
cctaagtatcagcctctcggtcacgagaagcctggtgaagttgttgaggatgacgaggat
gacgagactgtcgacaaggccgccaagttcacccttggtcttgttgccaagggagccgtg
attgtctccttcctcttttaccttggtatgtttgtctaccattgcacctgggtcacttct
aacgcttactcttcaccctccgttgttcttgcctctcgaatgccggacggctctcagcat
ctcattgatgactaccgagaggcttactactggcttcgaatgaacacccccgaggatgct
cgaatcatgtcctggtgggattacggctaccagattggaggaatggccgaccgaaccact
cttgtggataacaacacgtggaacaatacccacattgctactgttggcaaggctatgtct
tcctccgaggaggtggcgtaccccatcctgcgccagcacgatgtggattacgttcttgtc
atcttcggcggccatcttggctactccggagacgacatcaacaagttcctgtggatggtg
cgaatcgccgagggcatttggcctgacgagatcaaggagcgaaactacttcactcctgct
ggcgagtacaaggttgacgacaaggcgtccgaggccatgaagaactcgctcatgtacaaa
atgtcgtactaccggttcgcggagggcacacaaaagcctgaccgagttcgaaaccagtgg
atcccccctactcctatcgagctcaacactctcgaggaggcttacaccacagaaaactgg
ctggtgcgtctctataaggtcaaggacctcgataacctgggacgcgatctgaagagcgcc
aagagctttgacactggaaaggccaagaagaagggcaaggctgcgtactcggagaagcga
gccttcgaacttagagagtag

DBGET integrated database retrieval system