KEGG   Yarrowia lipolytica: YALI0B16896gHelp
Entry
YALI0B16896g      CDS       T01033                                 

Definition
(RefSeq) YALI0B16896p
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:yli03041]
    YALI0B16896g
   03009 Ribosome biogenesis [BR:yli03009]
    YALI0B16896g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YALI0B16896g
Spliceosome [BR:yli03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    YALI0B16896g
Ribosome biogenesis [BR:yli03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    YALI0B16896g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 2907091
NCBI-ProteinID: XP_500994
UniProt: Q6CEB8
Position
B:complement(2221677..2223938)
Genome map
AA seq 753 aa AA seqDB search
MVKGKVTKPVKKATKSKQSAAMISKVKDDFVMTLDSDGEDLEEESADEKEEVEEKPVKLT
KKQKKQKLSEADEELLEREKQAAKAGINPDFQFSLDGFAATSEGLDGWNFEVSKDDNKVQ
KREVDLDSIIKRKGGLLDEDEDEDEAETDVKMEENEDDLAIDGFGGGVQPGKDMDEPEDE
DEENKEEVENEEEEDSDGSDSEAEECMHPDDLVLDDHKGPAIDEGPQDTAEEMAAFYAPE
EENNDKTESVHKTFQTLNLSRPVMKGISALGYQAPTPIQSRTIPIALMGKDLVAGAVTGS
GKTAAYIIPVLERLLYKSSKVAATKVVVLTPTRELSIQVADVGKKLAQYVSGVRFGLAVG
GLNLRVQEQELKTRPEVVIATPGRFIDHVRNSPSFNVDDVEILVIDEADRMLEEGFQQEL
TEILTLLPKKRQTLLFSATMNSSISSLIQLSLSRPVRVMINPPKQAASGLVQEFVRIRKR
DHLKPALLASILKKMDKEQRTIIFVARKETAHRLRIMLGLLGVRIGELHGALSQEQRLQS
ITAFKKLEVPILVCTDLASRGLDIPKIECVVNYDMPQTHAVYLHRVGRTARAGREGRSIT
LVGEAAADRAIVREAIKSVSESKQGKAVGRNVDWPEVEKLYSKIEEKGDIVNEILAEEKE
EKAMLQAEMEVRKGENLLKYEKEIASRPRRTWFQNAQEKKADETSDKRNLLASNKDKMKK
KKDNEEVRMYKKTKTDRKEASKRGKPKGKGKRK
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagggaaaagtgaccaaaccggtcaagaaggctactaagtccaaacaatcggct
gccatgatttccaaagtaaaggacgactttgtcatgactctagattccgacggtgaagat
ctggaggaggagagtgcagacgagaaggaagaggtggaggagaagcctgtcaagctgaca
aagaagcagaagaagcaaaaactcagtgaagccgacgaggagctactggagcgagaaaag
caggctgccaaggccggcatcaaccccgacttccagttttcgctggacggatttgctgcc
acctctgaaggtctggacggctggaactttgaggtgtccaaggacgacaacaaggtccag
aagcgagaagttgatttggacagcattatcaagagaaaaggaggccttctggacgaggac
gaggacgaggacgaggccgagacagacgttaagatggaggagaacgaagatgatctggcc
attgatggtttcggaggaggagtccagcccggaaaggacatggatgagcctgaggacgag
gacgaggagaacaaagaagaggttgagaatgaagaggaggaggactctgatggaagcgac
tccgaggctgaggagtgtatgcaccccgatgatttggttttggatgaccataaaggccct
gccatcgacgagggaccccaggacactgccgaggagatggctgcattctacgctcccgag
gaggagaacaacgataagactgagtctgtgcacaaaacctttcagactctgaatctgtct
agacccgtcatgaagggtatttctgctctgggataccaggcccccactccgattcagagc
agaaccatccccattgctctcatgggcaaggatctggttgctggtgccgtcactggttct
ggtaagactgctgcgtacatcattcctgttttggagcgtcttctctacaagtcctccaag
gtcgcagccactaaggttgtggttctgactcccactcgagagctgtccattcaggtcgcc
gatgttggtaagaagctcgcacagtatgtttctggcgtgcgattcggtctggctgtcggt
ggtctgaaccttcgagttcaggagcaggagctcaagacgcgacccgaggttgtcattgct
acccccggtcgatttattgatcatgttcgaaactctccctcgttcaacgttgacgatgtc
gagattctggtgattgatgaggctgatcgaatgctggaggagggtttccaacaggaactg
accgagattctgacactgcttcccaagaagcgtcagactctgcttttctctgccactatg
aattcgtccatttcgtcgcttattcagctgtctctttctcggcccgttcgagtcatgatc
aaccctcccaagcaggccgcttctggtctggtgcaagagtttgttcgaatccgtaagcga
gaccatctcaagcccgctctgctggcctccatcctcaagaagatggacaaggagcagcga
accattattttcgtggcccgaaaagagactgcgcatcgtcttcgaatcatgctgggtctg
ctcggagtccgaattggagaactgcacggagctctgtctcaggagcagcgtctgcagtcc
atcacagcattcaaaaaactggaggtgcccattctggtctgtaccgatctggcttcccga
ggtctggatatccccaagatcgagtgtgtcgtcaactacgacatgccccagacccatgct
gtctacctgcatcgagttggacgaactgctcgagcaggacgagaaggtcgatccatcact
ctggtcggggaggctgctgctgacagagccattgtccgcgaggctatcaagtctgtatct
gagagtaaacagggcaaggccgtgggccgaaacgtggactggcctgaggtcgagaagcta
tactccaagatcgaggagaagggtgacattgtcaacgagattctggctgaggagaaggag
gagaaggccatgctgcaggccgagatggaggtgcgaaagggagagaaccttctcaagtac
gagaaggagattgcatcccgacctcggcgaacttggttccagaatgcccaagagaagaag
gctgatgagacctcggacaaacgaaatctactagccagcaacaaggacaagatgaagaag
aagaaagacaacgaggaggtccgaatgtacaagaagaccaagaccgatcgaaaggaggcc
tctaagcgaggtaagcccaagggaaagggtaagcgaaagtga

DBGET integrated database retrieval system