KEGG   Yarrowia lipolytica: YALI0B19558g
Entry
YALI0B19558g      CDS       T01033                                 

Definition
(RefSeq) YALI0B19558p
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yli03016]
    YALI0B19558g
Enzymes [BR:yli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     YALI0B19558g
Transfer RNA biogenesis [BR:yli03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    YALI0B19558g
 Prokaryotic type
    YALI0B19558g
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_25 MTS Methyltransf_12 Methyltransf_31 Methyltransf_32 DUF2431 Methyltransf_11
Other DBs
NCBI-GeneID: 2907246
NCBI-ProteinID: XP_501100
UniProt: Q6CE12
Position
B:complement(2579890..2580768)
AA seq 292 aa
MLKRDQSEMDIEAETANMGKEEKESFVHKRQKYRQEQEEKRLAAKKGVSFEQPEDGEIKL
PKKRYYRQRAHSNPFSDHQLEYPESPADMDWDVLYPNRKEGQKVEVADIGCGFGGLLVAL
SPQLPNQLILGMEIRVQVTNYVEDRIVALRHQNKETDGYQNISVLRGNAMKFLPNFFEKG
QLSKIFFCFPDPHFKQRKHKARIVTTTLCSEYAYVVRPGGIVYTITDVKDLHEWMVKHLA
AHPLFERLTKEEEDADPCVATMLVETEEGKKVARNEGDKFVACFRRKENPEW
NT seq 879 nt   +upstreamnt  +downstreamnt
atgttgaaacgagatcagagcgaaatggacattgaggcggagactgctaacatgggaaag
gaggagaaggaatcctttgtgcacaagcgacaaaagtaccgacaagagcaggaggagaag
cgactggcagccaagaagggagtatccttcgagcagcccgaggacggcgagatcaagctc
cccaagaagcgatactacagacagcgagctcattcgaatcccttctctgaccatcagctg
gagtatcccgagtcgcccgccgacatggactgggacgtactttaccccaaccgaaaggaa
ggccagaaggtcgaggtggcagacattggatgtggattcggaggcttgctggttgctctc
tccccccagctgcccaaccagctgatcctgggaatggagatccgagtgcaggttactaac
tacgtggaggaccgaattgtggctcttcgacaccagaacaaggagaccgacggctatcag
aacatcagtgttctgcgaggcaacgctatgaagttcctgcccaacttcttcgaaaaaggc
cagctgtccaagatcttcttctgcttccccgatcctcacttcaagcagcgaaaacacaag
gctcgaatcgtcaccaccaccctgtgctccgagtacgcctatgttgtgcgacctggagga
atcgtctacaccatcaccgacgttaaggatctgcacgagtggatggtcaagcatttggcc
gctcaccctctatttgagcgactgaccaaggaggaggaggacgctgatccttgtgtggcc
accatgctggtcgagaccgaggagggcaagaaggtggcccgaaacgagggagataagttt
gttgcatgcttccgacgaaaggagaaccctgagtggtaa

DBGET integrated database retrieval system