KEGG   Yarrowia lipolytica: YALI0B23298g
Entry
YALI0B23298g      CDS       T01033                                 

Definition
(RefSeq) YALI0B23298p
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
yli  Yarrowia lipolytica
Pathway
yli00100  Steroid biosynthesis
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    YALI0B23298g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     YALI0B23298g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF3278
Other DBs
NCBI-GeneID: 2906662
NCBI-ProteinID: XP_501260
UniProt: Q6CDK2
Position
B:complement(3038241..3039557)
AA seq 438 aa
MTAKSKTTVIDGKTQRLNPKTTDLDFFGIPGATFITLTLPLFILFLQIGCTPESCTVAGV
LNIDWSAEMTKLRAMPLFDINVFGVYLTWFFSLAACDLILPGPVAEGVVLRDGKTRLKYN
LNGKTVMTTLAVILAARWVQTGGAMPELVFCYDHYVQIATSAIVWSFIVATYVYVASFTH
DCILSVGGNSGNPIFDWFIGRELNPRIGSFDIKYFCEMRPGLLLWAVLNLAMAHHEYITK
GFVSLPMALVVLMEIYYVVEGNWEEYGAIHMMDITTDGFGFMLAFGDLAWVPFVYTVQAR
YLSTRTIEYPLWYAGIIVTLFATGYYIFRASNNEKNAFKHGDAPHLRYIENDKGNKLIVS
GWWGAARHVNYLGDWLISWAWCLATGYESIFPYFFVAYFGVLLVHREMRDDHKCALKYKE
LWVQYKKAVPSAIIPGIY
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgacagccaagagcaaaacgacggtcattgacggcaaaacccagcgactaaaccccaag
accacggacctcgacttctttggaatccctggagccacctttatcacccttacgctgccg
cttttcatcttgtttctacagatcggatgcactccagagtcttgcacagtggctggtgtg
ctgaatattgactggtcagcggagatgaccaaactaagagccatgcctctgtttgatatc
aatgtcttcggcgtctatctgacctggttcttctccctggcagcatgtgatctgatcctg
cctggccccgtggctgaaggggtggttctgcgagatggaaagacccgactcaagtacaat
ttgaatggaaagaccgtaatgaccacattggcagtcattctggctgctcgatgggtgcag
actggaggagctatgcccgaacttgtgttctgctacgaccactacgtccagattgccacg
tctgccattgtgtggtcctttattgttgccacttacgtctacgtggcctcttttactcac
gactgcattctgtctgttggaggtaattctggaaaccccattttcgactggttcattggc
cgagagcttaacccccgaatcggctcctttgacatcaagtacttttgcgagatgcggcct
ggtctgcttctgtgggctgtgctcaatcttgcaatggctcaccatgagtacatcaccaag
ggctttgtgtctctccccatggcacttgttgttctgatggagatctattatgtagtagag
ggaaactgggaggagtatggagccatccacatgatggatatcaccactgatggattcggg
ttcatgctggcctttggagatcttgcttgggtcccctttgtgtacaccgttcaggcccga
tacctgtctacccgaacgattgagtaccctctatggtatgctggtatcattgtgactctt
tttgctaccggatactacattttccgagcctcaaacaatgagaagaatgcgttcaagcac
ggagacgctcctcacctgaggtacattgagaacgacaagggcaacaagctcatcgtcagt
ggctggtggggtgcagctcgacatgtcaattacctaggagactggctcatttcttgggcc
tggtgtcttgccactggttacgagagcatcttcccttacttctttgtggcctactttgga
gtgctgctggtccatcgagagatgcgagatgaccacaagtgtgctctgaagtacaaggag
ctctgggttcaatacaagaaggctgttcccagcgctatcatcccaggcatctactaa

DBGET integrated database retrieval system