KEGG   Yarrowia lipolytica: YALI0D02805g
Entry
YALI0D02805g      CDS       T01033                                 

Definition
(RefSeq) YALI0D02805p
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
yli  Yarrowia lipolytica
Pathway
yli04138  Autophagy - yeast
yli04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:yli00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YALI0D02805g
   04138 Autophagy - yeast
    YALI0D02805g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:yli04131]
    YALI0D02805g
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:yli04812]
    YALI0D02805g
Membrane trafficking [BR:yli04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    YALI0D02805g
Cytoskeleton proteins [BR:yli04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     YALI0D02805g
SSDB
Motif
Pfam: ARPC4
Other DBs
NCBI-GeneID: 2910543
NCBI-ProteinID: XP_502341
UniProt: Q6CAH1
Position
D:complement(join(357405..357413,357721..358218,359477..359479))
AA seq 169 aa
MSQSLRPYLLAVRTSLTAALCLEDFGSQVAERHNVPEVESGKSAEALLNPMTIARNENEM
VLIEPSINSVRVSIRIKQADEIERILVHQFTRFLTGRAESFYILRRKPVPGYSISFLITN
FHTETMLKHKLVDFIIEFMEVVDKEISEMKLVLNARARFIAESYLVAFD
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtcccaatccctccgaccctaccttcttgccgtacgtacctctctcacagcagccctc
tgtctggaagactttggctcgcaggtggcagagcgacacaatgtgcccgaggtggagtcc
ggcaagtcagctgaggcgctgctcaaccctatgaccattgcgcgaaacgaaaacgaaatg
gtgctgatcgagccatccatcaactcggtgcgagtgtcgattcgaatcaagcaggcggac
gagattgaacggattctcgtgcaccagttcacgcggttcctgaccggccgagccgagtct
ttctacattctgcgacgaaaacccgtgcctggatacagcatttcgttcctcatcacaaac
ttccacaccgagaccatgctcaagcacaagctggtggactttatcattgagtttatggag
gtggtcgacaaggagatcagtgagatgaagctggtgctcaatgccagagcgcgatttatc
gcagagagttatttggttgcgttcgactaa

DBGET integrated database retrieval system