KEGG   Yarrowia lipolytica: YALI0D09273gHelp
Entry
YALI0D09273g      CDS       T01033                                 

Definition
(RefSeq) YALI0D09273p
  KO
K08738  cytochrome c
Organism
yli  Yarrowia lipolytica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 2910838
NCBI-ProteinID: XP_502612
UniProt: Q6C9Q0
Position
D:1176675..1176998
Genome map
AA seq 107 aa AA seqDB search
MGYKEGSAKKGATLFKTRCAQCHTTEAGGPHKVGPNLHGVINRHSGEAEGYSYSDANKRK
GIEWTTEHLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITWMVENC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaaggaaggttccgctaagaagggtgctactctcttcaagactcgatgcgct
cagtgccacaccaccgaggccggaggaccccacaaggtcggccccaacctccatggtgtc
atcaaccgacactccggagaggccgagggctactcttactccgatgccaacaagcgaaag
ggtattgagtggaccaccgagcatctgtttgagtacctcgagaaccccaagaagtacatt
cccggtaccaagatggctttcggaggtctcaagaagcccaaggaccgaaacgatctgatc
acctggatggtcgagaactgctaa

DBGET integrated database retrieval system