KEGG   Yarrowia lipolytica: YALI0D15268gHelp
Entry
YALI0D15268g      CDS       T01033                                 

Definition
(RefSeq) YALI0D15268p
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
yli  Yarrowia lipolytica
Pathway
yli00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:yli00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YALI0D15268g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:yli01007]
    YALI0D15268g
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yli03016]
    YALI0D15268g
Enzymes [BR:yli01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     YALI0D15268g
Amino acid related enzymes [BR:yli01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   YALI0D15268g
Transfer RNA biogenesis [BR:yli03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YALI0D15268g
 Prokaryotic type
    YALI0D15268g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 2910753
NCBI-ProteinID: XP_502853
UniProt: Q6C909
Position
D:1857268..1859499
Genome map
AA seq 743 aa AA seqDB search
MDSSAVKQPEWHAPKEPQSRDTLKLYNSLTRSKTAFVPIAGNKVTWYCCGPTVYDSSHMG
HARNYVSTDINRRILQDYFGYDVLFVQNVTDIDDKIIIRGRQQHLFQKYVEENKGLSQEV
LSKVLSSWNDFAKDKLGYTDEVADFEKYVESETTKLKSIEDAKFKMNLASAQAAAKALTD
KTVTPDIFYPAVKDVLVLTLDQEQGSTVSDHKIFRELSAFWEGEFDKDMAKLNVLAPSVT
TRVSEYVPEIVEYVEKIIDNGYAYVSDSGVYFDTAAFDKSHDYAKLQPWNKGHADLIDEG
EGSLSNKTGKRNSSDFALWKASKPGEPFWDSPWGQGRPGWHIECSVMASAILGPQMDIHS
GGIDLAFPHHDNELAQSEAHYDCKQWVNYFLHTGHLHIEGQKMSKSLKNFITIDEALQTY
SPRQLRLAFALQQWNNQLDFKSALISEVKSVESTFSKFFAKVRALKGEVEDKVSKGVLVS
KKTGPAELALLNALSDCKEAVHIALCDNLATPAAIQNMVQLVGKVNLYLGETSTENVRTE
ILVDVATFISKMFAVFGFRTRTDNLGFTEESSEASSEALIMPYLTTLRNFRDDIRGKAMA
RAAHLEFLQATDQVRFDLLKQGVSLDDRGVGEPALIKILSDSEKLELIKAQEEKEKRAAE
KAAKREAQAKLEAQKVAEREAKAKIAPKDLWKDDPAYSQWDEDGIPTHNAEGEAISKSLK
KKLTKQHEAQKKLYHDYEGQILE
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggactcctccgccgttaaacaacccgagtggcacgctccgaaagagccccagtctcgt
gacaccctgaagctgtacaactcgttgactcgatccaagactgcttttgttcccattgct
ggcaacaaggtcacctggtactgctgcgggcccaccgtctacgactccagccacatgggc
catgcccgaaattacgttagcaccgacatcaaccgacgaattctacaggactactttgga
tacgatgttctgttcgtgcagaatgtgactgacattgacgataagatcatcatccgaggc
cgacagcaacacctgttccaaaagtacgttgaggagaacaagggtctgtctcaggaggtg
ctgtcaaaggttctcagcagctggaacgatttcgccaaggacaagctcggttacactgat
gaggttgccgatttcgagaagtacgtggagtcggaaacaactaaactcaagtcaatcgaa
gacgccaagttcaagatgaacctagcaagcgcacaggctgctgctaaggctctcaccgac
aagaccgtcacaccagacattttctaccctgctgtcaaggatgttcttgtgctcacactg
gatcaggagcagggctccaccgtgtcggaccacaagatcttccgagaactgtctgcgttc
tgggagggtgaattcgacaaggacatggcaaaactcaacgttctggccccctctgtcaca
actcgtgtctctgagtacgttcctgagattgtcgagtacgtggagaagatcatcgacaac
ggctacgcctacgtcagcgattccggcgtgtacttcgacaccgctgccttcgacaagtcc
cacgactacgccaagctccagccctggaacaagggccatgctgacctgattgatgaggga
gaaggttctctttccaataagactggcaagcgaaattcctctgatttcgccctgtggaag
gcctccaagcccggtgagcccttctgggactctccttggggtcagggacgacctggatgg
cacattgagtgctctgtcatggcttctgccattctcggtcctcagatggacattcactct
ggaggtattgatctggcattccctcaccacgacaatgagcttgcccagagtgaagcccat
tacgactgcaagcagtgggtcaactacttccttcacactggccacctacacatcgagggt
cagaagatgagcaagtctctgaagaacttcatcaccattgacgaggccctccagacctat
tctccgcggcaactccgtctggcgttcgcccttcagcagtggaacaaccaactcgacttc
aagtctgccctgatttccgaggtcaagtccgtggagtccaccttctcaaagttttttgcc
aaggtccgtgctctcaagggcgaagttgaggacaaggtttcaaagggtgttcttgtttcc
aagaagaccggccctgctgagcttgccctgctgaacgctctgtccgactgcaaggaggcc
gttcacattgctctctgtgacaatctggccacacctgctgctattcagaacatggtgcag
cttgttggcaaggtcaacctttaccttggcgagacttccaccgagaatgtgcgaactgag
attctggttgatgttgccaccttcattagcaagatgttcgccgtctttggtttccgaact
cgaactgacaacctgggtttcaccgaagagtcttccgaggcttcttccgaggctctgatc
atgccctaccttaccactctgcgaaacttccgggacgacattcgaggtaaggctatggct
cgagccgctcatctcgaattcctgcaggccactgatcaggtgagattcgacctgcttaag
cagggcgtttcccttgacgaccgtggtgtcggcgagcctgccctgatcaagattctgtcc
gattctgagaagctggagctgatcaaggcacaggaggagaaggagaagcgagctgcggag
aaggctgccaagcgagaggcccaggccaagctggaggcgcagaaggttgccgagagagag
gccaaggctaagattgctcccaaggatctgtggaaggatgaccccgcttattcgcagtgg
gatgaggacggaatcccaacccataacgctgagggtgaagctatttctaagagtctcaag
aagaaacttaccaaacagcatgaggcccagaagaagctgtatcatgactacgagggacag
attttggagtaa

DBGET integrated database retrieval system