KEGG   Yarrowia lipolytica: YALI0D23331gHelp
Entry
YALI0D23331g      CDS       T01033                                 

Definition
(RefSeq) YALI0D23331p
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
yli  Yarrowia lipolytica
Pathway
yli00860  Porphyrin and chlorophyll metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YALI0D23331g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     YALI0D23331g
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     YALI0D23331g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 Thi4 DAO Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 2910274
NCBI-ProteinID: XP_503186
UniProt: Q6C826
Position
D:3035838..3037421
Genome map
AA seq 527 aa AA seqDB search
MSIQHTLYRPLKEGASLAILGGGIGGLLSAAFLARARPDIKITLYESKAQCGGWIKSKLL
ECHDGGSEMIEKGPRTLRMHPGTLILLQAISHVDPKFSIYGLPTDSPANTKWILNKDQLM
SLSVFKSPANLMRFLSSSVFRAMAMGAFNFLVYPWTRKRDPNVQDESVADFIGRRASPAL
GDRMGSAILHGIYAGDHKTLSARMTLRPFYGPDRLLKPAKLFTNEEFEKLYKKLFPEAST
SLFDLKKFPAMFAFPQGLSGMIDVLHKHLEKSPNVEIKCNTEITRVETTIGGMLVSDSTG
VSTTHNAVYSLLSYQAVSKLLPDTADRALIKDMSSVDVMVLNFSFEKPKDPKYTGFGYLI
PQAEENPEQVLGVIFDSDVGRGSELISGEPYKSPSGRENVTVMMGGHYWKDGNIPSSEEC
VERAKKVLKRHIGLEVTDTTEYDVELHKSCIPQYAVGHLERVDQFKHIVSKETHHRVALA
GMSFGRGVGISDAAVDAFLFVASQSHDPETLKLTRKIVDHYETTVRL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcaacacacactgtacaggccattgaaggagggagcgagtttggcgatcctt
ggaggcggaattggcggacttctatccgcggcattcctcgccagagcgcgcccagacatc
aaaatcacactgtacgagtcaaaggcgcaatgtggaggatggatcaagagcaagttgctt
gaatgccacgatggcggctcggagatgatcgaaaagggaccccgaacgctcagaatgcac
cccggcacactcattttactccaggccatttctcatgtggacccaaagttctccatctac
ggactacctaccgacagtccagccaacaccaagtggatcctcaacaaggaccaactcatg
tcgctgagcgtgttcaagagccccgcaaatctgatgcggttcctgtcgtcgtctgtcttt
cgagccatggctatgggcgccttcaacttcctcgtatatccatggacccggaaacgagac
cctaatgtccaagacgaaagcgtggctgatttcatcggaagacgagcctcgcctgctctg
ggcgatagaatgggctcagcgattctacacggaatctacgctggagaccacaagactctg
agtgctcgaatgactctgcgaccattctacggacctgatagactgctgaaaccggccaaa
ttgttcaccaacgaggagtttgagaaactgtacaagaagctgtttcccgaggcgtccacg
tcgctgtttgatctcaagaagttcccggccatgtttgcctttccccagggtctgtctgga
atgattgatgtactccataagcatctggaaaaaagtcccaatgtggagattaaatgtaac
acggagattaccagagttgaaaccaccattggaggcatgcttgtgtctgattctaccggt
gtttctaccactcacaatgccgtctactctctgttgagttaccaggctgtgtccaaattg
cttcctgacactgccgaccgagctctcatcaaggacatgtcttctgtcgacgtcatggtg
ctcaacttctcattcgagaaacccaaggaccccaagtacaccggctttggatacctcatt
ccccaggccgaagaaaaccccgagcaggttctgggcgttattttcgactctgatgtcggt
cgaggcagtgagctcatctctggtgagccctacaagtcgccttcgggccgagaaaatgtc
acagtcatgatgggaggtcattactggaaggatggtaatattccgtcttccgaggagtgt
gtggagagagcaaagaaggtgctcaaacgacacattggcctggaggtgactgataccacc
gagtacgatgtggagctgcacaagagctgcattcctcagtacgccgttggtcatctggag
cgtgtggaccagtttaagcacattgtcagcaaggagactcatcatcgagtggctctggca
ggcatgtcgttcggtcgaggagtgggtatctctgatgccgctgttgacgcctttttgttt
gtggctagtcagagtcatgatccggagacgttgaaattgacgagaaagattgtggatcat
tatgagaccaccgtacgactttag

DBGET integrated database retrieval system