KEGG   Yarrowia lipolytica: YALI0D26191g
Entry
YALI0D26191g      CDS       T01033                                 

Definition
(RefSeq) YALI0D26191p
Organism
yli  Yarrowia lipolytica
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 2910741
NCBI-ProteinID: XP_503304
UniProt: Q6C7Q8
Position
D:3481755..3483734
AA seq 659 aa
MPAPPPPPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPPKGAPSRDALFSDITKGNK
GRLKKTQTNDRSAAQTGGGGVLSGGAPKGPSSAPAVPGMGMGAPAVPGMGAPAVPGMGAP
AVPGMGAPAAPSAPAAASAPSAPAMAQQDMSGLFAGGMPKLKKRGGNISLTDDHSSSGNS
SPPQGGAPAIPSLRKTSGAPSAPGGFAPPPPPAPPGGAPAIPGAPSVASSYRSASASSGA
PPPPPGGAPPIPGGAPPPLPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTSSPK
PPPKPAKRPPALKPKPKIPTPGLKPAVPTPGQRRSVSPSPGAPPPPIPGSVAPSVRHAPS
QSVSSIASSVSTPSTPPPAPPAPPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFG
APTPPPAPPAPSAPPAPPAPPAPPSEPPSTPRGPAMFGAPMPKSPAAASPGAPPPPPPGA
AAPGLAPPAPPAQPPSPGRPSGAPPPPPGPPAPPTDQFHSMILDDGSSSGSHGAPPPPPP
SAPPSNGGHSHGAPPPPPPNGGVNRRRDVVQRTSTLGSNNIRTLDTSAYTIAPRAVSTPV
GSSSGGGGGSKPPQIKIDDSRWKWRNAHDLPKPRRFEGKTKLYASGRGSSVPLNLAAYE
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgccagctcccccaccacccccgccgccgccgccgcccggatttggaggaccgcctccc
ccacctcctcctggaggaggatttggagcattgtcgtctggaggagcacccaaagctggc
cctccaaagggcgctccttctcgagacgccctcttcagcgacatcaccaagggcaacaag
ggccgacttaagaagacacagacaaacgacagatctgcagcacagactggaggaggagga
gtgttgtctggaggcgctccgaagggaccctcctctgcacctgccgtgccgggcatgggt
atgggtgctcctgctgtgcctggaatgggagccccggccgttccaggcatgggagcacca
gcagttcctggtatgggagctcctgctgctccttcggcgcctgcagctgcgtctgcccct
tcagccccggcgatggcccagcaagacatgtctggcctgtttgctggaggtatgcccaag
ctcaagaagcgaggaggcaacatcagcttgacggacgaccacagcagcagcggtaactcg
tcgccacctcaagggggggctccagccatcccgtcgctgcgaaaaacttcaggagctccc
tcggcccccggaggtttcgctcccccgcctcctcccgctccccctggaggcgcccctgct
attccgggagctccatctgtggcctccagctacagaagtgcatcagcatcttctggtgcc
ccccctcctccccccggaggtgccccgcctattcctggaggagctcccccgcctctgcca
ggaaaagtcagcacctcaggaggtgctcccacttttggagctcctcctcctccgcctcca
ggtggagcccccgcatatggagctcccgctcctcctacaccgggcacttcatcgcccaag
cctcccccaaaacctgcgaaacgtcccccggccctcaagcccaagcccaagatccctact
ccaggcttgaagcccgcggtccctactcctgggcagcgacgatccgtgagcccttcacct
ggagccccacctcctcccattcccggttctgtggcgccgtcagtgcgccacgcaccttca
cagtcagtgtctagcatcgcgagctcagtcagcacccccagcacccctcctccagcccct
ccggcgcccccgcctgtgcctggaggagccgctcccccaattccaggctcagcggcccct
cccgctcctcctcccgctcctccagcaggttttggagcccctgctccccccagttttgga
gcacccacgccgcctccggctcccccagctccctcagctcccccagctcccccagctccc
ccagctccaccctcggaacccccgagcacacctagaggccctgccatgtttggagccccc
atgcccaaatcaccagctgctgcatcgcctggagctccccctccccctcctcctggggct
gctgcacctggtttggctcccccagctcctccagcacagcctccgtcgccaggacggccc
tctggagctcccccgcctcctcctgggcctcctgctccccctacagatcaatttcactca
atgattctggacgatggaagcagcagtgggagccatggtgctcctcctccccctcctccc
tctgcgccaccttccaacggaggacacagtcacggagcaccccctcctccccctcccaat
ggaggagttaacagacgtagggacgttgtccagcgaacttcgactctaggatcaaacaat
atccgaacgctcgacacgtcggcgtacaccatcgctccacgggctgtgagcacgcctgta
ggctctagctctggcggagggggaggttccaagccgccgcagatcaagattgacgacagt
cggtggaagtggagaaacgctcacgatctgcccaagcccagacggtttgagggtaaaaca
aaactgtatgccagtggccggggttcgtcggtgccccttaacctggctgcctatgagtaa

DBGET integrated database retrieval system