KEGG   Yarrowia lipolytica: YALI0E13706gHelp
Entry
YALI0E13706g      CDS       T01033                                 

Definition
(RefSeq) YALI0E13706p
  KO
K09490  heat shock 70kDa protein 5
Organism
yli  Yarrowia lipolytica
Pathway
yli03060  Protein export
yli04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:yli00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    YALI0E13706g
   04141 Protein processing in endoplasmic reticulum
    YALI0E13706g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:yli03110]
    YALI0E13706g
   04131 Membrane trafficking [BR:yli04131]
    YALI0E13706g
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yli04147]
    YALI0E13706g
Chaperones and folding catalysts [BR:yli03110]
 Heat shock proteins
  HSP70 / DNAK
   YALI0E13706g
Membrane trafficking [BR:yli04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    YALI0E13706g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YALI0E13706g
  Exosomal proteins of other body fluids (saliva and urine)
   YALI0E13706g
  Exosomal proteins of colorectal cancer cells
   YALI0E13706g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 2912786
NCBI-ProteinID: XP_503913
UniProt: Q99170
Position
E:complement(1656104..1658116)
Genome map
AA seq 670 aa AA seqDB search
MKFSMPSWGVVFYALLVCLLPFLSKAGVQADDVDSYGTVIGIDLGTTYSCVGVMKGGRVE
ILANDQGSRITPSYVAFTEDERLVGDAAKNQAANNPFNTIFDIKRLIGLKYKDESVQRDI
KHFPYKVKNKDGKPVVVVETKGEKKTYTPEEISAMILTKMKDIAQDYLGKKVTHAVVTVP
AYFNDAQRQATKDAGIIAGLNVLRIVNEPTAAAIAYGLDHTDDEKQIVVYDLGGGTFDVS
LLSIESGVFEVLATAGDTHLGGEDFDYRVIKHFVKQYNKKHDVDITKNAKTIGKLKREVE
KAKRTLSSQMSTRIEIESFFDGEDFSETLTRAKFEELNIDLFKRTLKPVEQVLKDSGVKK
EDVHDIVLVGGSTRIPKVQELLEKFFDGKKASKGINPDEAVAYGAAVQAGVLSGEDGVED
IVLLDVNPLTLGIETTGGVMTKLINRNTNIPTKKSQIFSTAVDNQSTVLIQVFEGERTMS
KDNNLLGKFELKGIPPAPRGVPQIEVTFELDANGILRVTAHDKGTGKSETITITNDKGRL
SKDEIERMVEEAERFAEEDALIRETIEAKNSLENYAHSLRNQVADKSGLGGKISADDKEA
LNDAVTETLEWLEANSVSATKEDFEEKKEALSAIAYPITSKIYEGGEGGDESNDGGFYAD
DDEAPFHDEL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctctatgccttcgtggggcgtcgttttttacgccctcctggtatgccttctg
cctttcctttccaaggccggcgttcaggctgatgacgtggactcttatggcaccgtcatt
ggtatcgatctgggtaccacctactcctgtgttggtgtcatgaagggtggccgagtcgag
attctggccaacgaccagggttctcgaatcaccccctcctacgtggccttcaccgaggac
gagcgactcgttggagacgctgccaagaaccaggctgccaacaaccctttcaacaccatt
ttcgacattaagcgactcattggtcttaagtacaaggacgagtccgtccagcgagacatc
aagcacttcccctacaaggtcaagaacaaggacggcaagcccgttgttgttgtcgagacc
aagggcgagaagaagacctacacccccgaggagatctccgccatgattcttaccaagatg
aaggacattgcccaggactaccttggcaagaaggtcacccacgctgtcgtcaccgtccct
gcctacttcaacgatgcccagcgacaggccaccaaggatgccggtatcattgctggtctc
aacgttctgcgaattgttaacgagcccaccgctgccgccattgcctacggcctggaccac
accgatgacgagaagcagattgttgtctacgatcttggtggaggaaccttcgatgtttct
cttctgtctatcgagtctggtgtctttgaggttcttgccactgctggtgacacccatctt
ggtggtgaggatttcgactaccgagtcatcaagcactttgtcaagcagtacaacaagaag
cacgacgtcgacattaccaagaacgctaagaccattggtaagctcaaacgagaggttgag
aaggccaagcgaactctgtcttcccagatgtccactcgaatcgagattgagtccttcttc
gatggagaggacttctcggagaccctgacccgagccaagttcgaggagctcaacattgat
ctgttcaagcgaaccctcaagcccgttgagcaggttctcaaggactctggcgtcaagaag
gaggatgtccacgacattgttcttgttggtggttccacccgaatccccaaggtccaggag
ctgctggagaagttctttgacggcaagaaggcctccaagggtatcaaccccgatgaggct
gttgcttacggagctgctgtccaggctggtgttctttccggcgaggacggtgttgaggac
attgtcctgctcgatgttaaccccctgactcttggtattgagaccactggtggtgtcatg
accaagctcatcaaccgaaacaccaacatccccaccaagaagtcccagattttctccacc
gctgttgacaaccagtctaccgtgctgattcaggtctttgagggagagcgaaccatgtcc
aaggacaacaacctgcttggtaagttcgagctcaagggtattccccctgctccccgaggt
gtcccccagattgaggtcaccttcgagcttgacgctaacggaattctgcgagtcaccgcc
cacgataagggcaccggcaagtccgagaccattaccatcaccaacgacaagggccgtctc
tccaaggacgagattgagcgaatggttgaggaggctgagcgatttgccgaggaggatgct
ctcatccgagagaccattgaggctaagaactctctcgagaactacgcccactctctccga
aaccaggttgctgacaagtctggtctcggtggcaagatttctgccgacgacaaggaggct
ctcaacgacgctgtcaccgagactctcgagtggctggaggccaactccgtgtctgccacc
aaggaggactttgaggagaagaaggaggctctgtctgccattgcctaccccatcacctcc
aagatctacgagggtggagaaggtggagacgagtccaacgacggtggattctacgctgat
gatgatgaggctcctttccacgatgagctttaa

DBGET integrated database retrieval system