KEGG   Yarrowia lipolytica: YALI0E17831gHelp
Entry
YALI0E17831g      CDS       T01033                                 

Definition
(RefSeq) YALI0E17831p
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:yli01002]
    YALI0E17831g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     YALI0E17831g
Peptidases and inhibitors [BR:yli01002]
 Metallo peptidases
  Family M16: pitrilysin family
   YALI0E17831g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 2911687
NCBI-ProteinID: XP_504079
UniProt: Q6C5I3
Position
E:complement(2103533..2106337)
Genome map
AA seq 934 aa AA seqDB search
MLPHLRNGLKLAMETPIVKPRLDSRDYKSVRLGNRLEALLVADKTTTMSSASLAVHAGYY
DDPEDLPGLAHFCEHLMFLGTKKYPRENEYKQFILTNSGASNAFTSTQITNYHFQIKNSA
FQEAVDRFAQFFIEPLFDPDCKDREINAVNSEHEKNTQLDSRRILHVSRLTGSKEHPHHK
FSTGSKHTLDKPGVRDRLLEFHKNQYCASKMRLVLMGRDMGELENLVQVFEDIPNKNLPI
PVLKQPMLDPRNSFLQIVPLSEKRFVKYEFEVPGWRQLGEYSVNSYYAQLVGHESPGSLY
WYLKQKGWADSVSAHINYLSSEGGLFSVTVNLTTEGAQHTEEIGAALFEYLAMLRAEGPQ
KWFFDESKDICQLFFDFKETPTQIMSEASALSATFANKQCAASEVVSYNHLMKTYNAEVL
EEFLTRLTPDNLRVTLVAPEVKDKCDLTEQHCGTKYSVSQLKKETVDKFSEALKSSFPKR
FHLPQKNPYIAEEFTILNEKKEDIPLTEHYKPKTLSPTLSYFPDHMFETPKGMIIVGLNH
PNTSDTVRNSLLTRLACSLWSDAAEKYSYDAASAGLGLSIHRGTYGVIVQVAGFNDKLSV
LLDQSYETLKSDIDPGRFSLRLERLKRALSNAKFNSSFQIIDEYLSAEVDEQQFTLEERL
ASIEEKEITLEEVRAHMAKIISECSPRVLVSGNFSESKAHEIHGRVIEEFKCGDVLNLPQ
KLISTPLYGSKIAARPSLNVDNADNCVLYYFESTQVEKARLLAYIIKEPAFTFLRTKKQL
GYVARAGFERNFSTGGLSLLTQSAYHADDVKALMDEFLTVHMAAIMEKMTVEEFEKYTAG
FIAQVSKPPKSLMVQSRHVWSKLCNSWGFNVDAEAIELAKTVSLEEMKQFYNELFDTDKR
SLCVQINTSKESKRYDLEDKKGRTNKGGHISANI
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgctcccacatctgagaaacggcctgaaactcgccatggaaacaccaattgtgaaaccg
cgtctggattcgcgcgattacaagtctgtgcggctcggcaaccgcctcgaggctctgctg
gtggcagacaagacgaccaccatgtcttcggcctctctagccgttcatgccggctactac
gatgatcccgaagacttgcctgggctggcgcatttctgcgagcacctcatgtttctgggc
accaaaaagtaccctcgcgagaacgagtacaagcagttcattttgaccaacagcggcgct
agtaacgccttcacgtccacccagatcaccaactaccacttccagatcaaaaacagcgcg
ttccaagaagccgtggaccgctttgcgcagtttttcatcgagccgctattcgatccggac
tgcaaagaccgtgaaatcaacgccgtcaactcggagcacgagaaaaacacacagttggac
tccaggcgtatcttgcatgtatctagactgacgggtagtaaagagcacccccaccacaag
ttcagtacaggcagcaaacacactctggacaagcctggagtgcgagatcggcttctagag
ttccacaagaaccagtattgtgcgtccaagatgcgcctggtgctcatgggccgcgacatg
ggcgagctggagaatctggtgcaggttttcgaggacattcctaacaagaacctgcccatt
ccagtactcaaacagcccatgctggacccccgaaactcgtttctgcagattgtgccgctc
tcagagaaacggtttgtcaagtacgaatttgaggtgcctggatggagacaactgggagag
tactccgtcaattcgtactacgcacagctggtgggccacgaatcacccggaagtctgtac
tggtacctcaaacaaaagggctgggccgactctgtgtctgctcatatcaactatctctct
tccgagggagggctcttttctgtgacagtgaatctcaccactgagggtgcacagcatact
gaagaaatcggagcagctctattcgagtatttggctatgctgcgggctgagggcccccaa
aagtggttctttgatgagtccaaggacatctgtcagctgtttttcgatttcaaagagact
cccactcagatcatgagcgaggcatccgcattgtcagcaacttttgccaacaagcagtgt
gctgcatcggaggtagtgagctacaaccacctgatgaagacctacaatgcagaagttctg
gaggagtttctgaccagattgactcctgataacctcagagtgactcttgtggctcctgaa
gtgaaggacaagtgtgatttgactgaacagcactgcggaaccaagtatagtgtttctcag
ttaaagaaagagactgtggacaagtttagtgaggcgctcaaatcttcttttcccaagaga
ttccatctccctcagaaaaatccttacattgcagaggagtttactattttgaatgagaag
aaagaagatatccctttgacagagcactacaagcccaagactctctctcccacattgtct
tacttcccagatcacatgtttgaaacccccaaaggtatgattattgtcggattgaaccat
ccaaatactagcgacacagtcagaaactcattgctaacccgtctcgcatgcagtctgtgg
agtgatgctgctgaaaagtactcgtacgatgctgcctctgccggtctcggtctttccatc
cacagaggcacctatggagtgattgtgcaggttgctgggttcaatgacaagctgtctgtg
ttgttggatcagtcgtacgagactctcaagtctgatatcgaccctggacggtttagtctg
cgtcttgagcgactcaagcgagctctttccaacgccaagttcaacagctcgttccagatc
attgacgagtatctttctgccgaagtcgatgagcaacagttcactttggaagagcgtcta
gcttccatagaagaaaaggaaatcactcttgaggaagtcagggctcatatggccaagatc
atttccgaatgctctcctcgagttttggtctcaggcaatttcagcgagtccaaggcccat
gagattcatggcagagttattgaagagttcaagtgtggagatgtgcttaatctgcctcaa
aaactgatctctacacccctttatggctccaagattgctgctagaccctctctcaatgtg
gacaatgctgacaactgtgttctgtattactttgagtcgacgcaggttgaaaaggcccgc
ctgttggcttatataatcaaggagcctgcgtttacgtttctgcgaaccaagaaacagctt
ggttacgttgctcgagcgggatttgaacgcaacttttccactggtggtctttctctactc
acccagtcggcctaccatgctgacgatgtcaaggctctaatggacgagttcctcactgtg
cacatggctgccattatggaaaagatgacggtcgaggagtttgaaaagtacactgctgga
ttcattgcccaggtgtccaaacctcccaagtcgttgatggtacagtctcggcatgtttgg
agcaagctgtgcaacagctggggcttcaatgttgacgccgaagcaatcgagctggccaaa
acggtgtctcttgaagagatgaagcagttctacaatgagctgtttgatactgacaagcgg
tctctttgtgtgcagatcaacacgtccaaggagagcaagcggtatgatctggaggataag
aaggggagaactaacaagggcgggcatatttctgccaacatttga

DBGET integrated database retrieval system