KEGG   Yarrowia lipolytica: YALI0E23265gHelp
Entry
YALI0E23265g      CDS       T01033                                 

Definition
(RefSeq) YALI0E23265p
  KO
K14298  mRNA export factor
Organism
yli  Yarrowia lipolytica
Pathway
yli03013  RNA transport
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0E23265g
Messenger RNA biogenesis [BR:yli03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YALI0E23265g
Chromosome and associated proteins [BR:yli03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YALI0E23265g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 2912291
NCBI-ProteinID: XP_504301
UniProt: Q6C4W1
Position
E:2735233..2736333
Genome map
AA seq 366 aa AA seqDB search
MSSVFGSARTTSGFGGLTQTSSAGTVQDMANDPTLANPPEDSVSDICFSPQAEFLSVASW
DKKVRIYEVSPQGQSRGVALYDHQAPVLSTHWSLDGTKVASGGCDNAVRVFDMQSQQAQQ
VGQHESSVRCVRFVAAGPSDTPILASAGWDKKLHYWDLRTPNPVSTIALPERAYSMDTSK
QLLVVATAERHILAINLSNPGAVAKTLQSSLKFQTRVVSCWPAGDGFAVGSIEGRCGIQY
VDDTQAKNKNFSFKCHRQTPNPSKNEVDIYAVNAISFHPQEGTFCTAGADGSLTFWDKDS
RHRLKGYPQLGCTIPATAFNRDGSIFAYAQSYDWSKGHSYNNKDIPHTVRFHQTKAEEVK
AKPKRR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcgtgtttggaagcgcaagaactacttcgggtttcggcggcctgacccaaacg
tcctcggccggcacggtccaggatatggccaatgaccccactctagccaatccgccggaa
gactctgtgtccgacatttgcttctctccacaggccgagtttctgtcggtggcgtcgtgg
gacaaaaaggtgcgcatctacgaggtgtctccgcagggccagtcaaggggagtggctctc
tacgaccaccaggcgccagtgctgtccacccactggtctttggacggaaccaaggtggcg
tctggaggctgtgataacgccgtgagggtgtttgacatgcaatcgcaacaggcgcagcag
gtcggccagcacgagtcgtccgtccgatgcgtgcgattcgtcgccgctggaccttcagac
acacctattctggcatccgcaggatgggacaagaagctgcactactgggacctgcgaact
cccaaccccgtgtccaccattgcgctgcccgagcgggcgtactccatggacacgtccaag
cagctgcttgttgtggcgaccgctgagcgacacattctggccatcaacctcagcaacccc
ggagccgtggccaagacgctgcagtcgtctctcaagttccagacccgtgtggtctcctgc
tggcccgccggcgacggctttgccgtgggctctatcgagggccgatgcggcattcagtac
gtggacgacacacaggctaagaacaagaacttctcgttcaagtgccaccgacagaccccc
aacccgtcaaagaacgaggtcgacatctacgccgtcaacgccatctcgttccatcctcag
gagggtactttctgcacggccggtgcagatggatcgctcaccttctgggacaaggactcc
cgccacagactcaagggctacccacaactaggatgcaccattcccgccacagccttcaac
cgcgacggctctatattcgcgtacgcacagtcgtacgactggagcaagggccactcatat
aacaacaaggacatcccccacacggtgcggttccaccagacaaaggccgaggaggttaag
gccaagcccaagcgaagatag

DBGET integrated database retrieval system