KEGG   Yarrowia lipolytica: YALI0E24013gHelp
Entry
YALI0E24013g      CDS       T01033                                 

Definition
(RefSeq) YALI0E24013p
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
yli  Yarrowia lipolytica
Pathway
yli00020  Citrate cycle (TCA cycle)
yli00640  Propanoate metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0E24013g
   00640 Propanoate metabolism
    YALI0E24013g
Enzymes [BR:yli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     YALI0E24013g
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YALI0E24013g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 2912694
NCBI-ProteinID: XP_504333
UniProt: Q6C4S9
Position
E:complement(join(2850991..2851939,2852580..2852617))
Genome map
AA seq 328 aa AA seqDB search
MYSAIRATRMGVRSFSTSAPVRSYADTVNNLKINSNTKVLFQGFTGKQGTFHAQQAIDYG
TKVVGGTNPKKAGQSHLGLPIFGTVAEAMKETGCDASAIFVPPPLAAASIEEAIEAELPL
VVCITEGIPQHDMIRVVDMLKTQSKTRLVGPNCPGIIAPGQCKIGIMPSSIHKRGRIGVV
SRSGTLTYEAVNQTTQVGLGQSLVVGIGGDPFAGTNFIDCLKVFLEDENTDGIIMIGEIG
GTAEEEAADFLKQYNQTREVPKPVCSFIAGVSAPPGRRMGHAGAIISGGKGGAGSKISAL
EAAGVAVEPSPARLGKTLYDEFVKRDLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtactccgccattcgagccacccgtatgggtgtcagatccttctccacttctgccccc
gtccgaagctacgctgataccgtcaacaacctgaagatcaactccaacaccaaggtgctc
ttccagggcttcaccggaaagcagggaaccttccacgcccagcaggccatcgactacggc
accaaggtcgttggaggaaccaaccccaagaaggccggccagagccatctcggtctcccc
atcttcggcaccgttgccgaggccatgaaggagactggatgtgacgcctccgccatcttc
gtcccccctcctcttgccgccgcctctatcgaggaggccattgaggccgagctgcccctc
gttgtctgtatcactgagggtatcccccagcacgacatgatccgagtggtcgacatgctc
aagacccagtccaagacccgacttgtcggtcccaactgccccggtatcattgctcccggc
cagtgcaagatcggtatcatgccctcttccatccacaagcgaggccgaatcggtgttgtg
tcccgatccggaacccttacttacgaggccgtcaaccagaccacccaggtcggtctcggc
cagtctctcgttgtcggtatcggaggtgacccctttgccggtaccaacttcatcgactgc
ctcaaggttttcctcgaggacgagaacaccgacggtatcatcatgatcggtgagattgga
ggtaccgccgaggaggaggccgctgacttcctcaagcagtacaaccagacccgagaggtc
cccaagcccgtctgctccttcattgccggtgtgtctgctcctcccggacgacgaatgggc
cacgctggagccatcatctccggtggtaagggtggtgccggctccaagatctctgctctt
gaggccgctggtgttgccgtcgagccttctcccgcccgactcggtaagactctttacgac
gagtttgtcaagcgagacctgctctag

DBGET integrated database retrieval system