KEGG   Yarrowia lipolytica: YALI0E26719gHelp
Entry
YALI0E26719g      CDS       T01033                                 

Definition
(RefSeq) YALI0E26719p
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yli  Yarrowia lipolytica
Pathway
yli00052  Galactose metabolism
yli00500  Starch and sucrose metabolism
yli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YALI0E26719g
   00500 Starch and sucrose metabolism
    YALI0E26719g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YALI0E26719g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 2912306
NCBI-ProteinID: XP_504435
UniProt: Q6C4H7
Position
E:complement(3172515..3174170)
Genome map
AA seq 551 aa AA seqDB search
MKLATAFTILTAVLAAPLAAPAEAFLFLLAGFAAKISASMTNETSDRPLVHFTPNKGWMN
DPNGLWYDEKDAKWHLYFQYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAPKRNDSGA
FSGSMVVDYNNTSGFFNDTIDPRQRCVAIWTYNTPESEEQYISYSLDGGYTFTEYQKNPV
LAANSTQFRDPKVFWYEPSQKWIMTAAKSQDYKIEIYSSDDLKSWKLESAFANEGFLGYQ
YECPGLIEVPTEQDPSKSYWVMFISINPGAPAGGSFNQYFVGSFNGTHFEAFDNQSRVVD
FGKDYYALQTFFNTDPTYGSALGIAWASNWEYSAFVPTNPWRSSMSLVRKFSLNTEYQAN
PETELINLKAEPILNISNAGPWSRFATNTTLTKANSYNVDLSNSTGTLEFELVYAVNTTQ
TISKSVFADLSLWFKGLEDPEEYLRMGFEVSASSFFLDRGNSKVKFVKENPYFTNRMSVN
NQPFKSENDLSYYKVYGLLDQNILELYFNDGDVVSTNTYFMTTGNALGSVNMTTGVDNLF
YIDKFQVREVK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgctaccgcctttactattctcactgccgttctggccgctcccctggccgcc
cctgcagaagctttccttttccttttggctggttttgcagccaaaatatctgcatcaatg
acaaacgaaactagcgatagacctttggtccacttcacacccaacaagggctggatgaat
gacccaaatgggttgtggtacgatgaaaaagatgccaaatggcatctgtactttcaatac
aacccaaatgacaccgtatggggtacgccattgttttggggccatgctacttccgatgat
ttgactaattgggaagatcaacccattgctatcgctcccaagcgtaacgattcaggtgct
ttctctggctccatggtggttgattacaacaacacgagtgggtttttcaatgatactatt
gatccaagacaaagatgcgttgcgatttggacttataacactcctgaaagtgaagagcaa
tacattagctattctcttgatggtggttacacttttactgaataccaaaagaaccctgtt
ttagctgccaactccactcaattcagagatccaaaggtgttctggtatgaaccttctcaa
aaatggattatgacggctgccaaatcacaagactacaaaattgaaatttactcctctgat
gacttgaagtcctggaagctagaatctgcatttgccaatgaaggtttcttaggctaccaa
tacgaatgtccaggtttgattgaagtcccaactgagcaagatccttccaaatcttattgg
gtcatgtttatttctatcaacccaggtgcacctgctggcggttccttcaaccaatatttt
gttggatccttcaatggtactcattttgaagcgtttgacaatcaatctagagtggtagat
tttggtaaggactactatgccttgcaaactttcttcaacactgacccaacctacggttca
gcattaggtattgcctgggcttcaaactgggagtacagtgcctttgtcccaactaaccca
tggagatcatccatgtctttggtccgcaagttttctttgaacactgaatatcaagctaat
ccagagactgaattgatcaatttgaaagccgaaccaatattgaacattagtaatgctggt
ccctggtctcgttttgctactaacacaactctaactaaggccaattcttacaatgtcgat
ttgagcaactcgactggtaccctagagtttgagttggtttacgctgttaacaccacacaa
accatatccaaatccgtctttgccgacttatcactttggttcaagggtttagaagatcct
gaagaatatttgagaatgggttttgaagtcagtgcttcttccttctttttggaccgtggt
aactctaaggtcaagtttgtcaaggagaacccatatttcacaaacagaatgtctgtcaac
aaccaaccattcaagtctgagaacgacctaagttactataaagtgtacggcctactggat
caaaacatcttggaattgtacttcaacgatggagatgtggtttctacaaatacctacttc
atgaccaccggtaacgctctaggatctgtgaacatgaccactggtgtcgataatttgttc
tacattgacaagttccaagtaagggaagtaaaatag

DBGET integrated database retrieval system