KEGG   Yarrowia lipolytica: YALI0E30591gHelp
Entry
YALI0E30591g      CDS       T01033                                 

Definition
(RefSeq) YALI0E30591p
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
yli  Yarrowia lipolytica
Pathway
yli00780  Biotin metabolism
yli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YALI0E30591g
Enzymes [BR:yli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     YALI0E30591g
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     YALI0E30591g
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     YALI0E30591g
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     YALI0E30591g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C Glyco_hydro_42M
Motif
Other DBs
NCBI-GeneID: 2912036
NCBI-ProteinID: XP_504596
UniProt: Q6C416
Position
E:complement(3599507..3601351)
Genome map
AA seq 614 aa AA seqDB search
MNVLVYNGPGSTPESVKHATESLRKLLSPYYSVHNVDAEVIKNEPWTESTALLVMPGGAD
LPYCSDLGGPGNKLIRNWIRAGGKYLGFCAGGYYGAQRVEFEEGTDLEVIGDRELSLYGG
KCVGSAYKGFVYDSHAGARAVGVNWKGSPFKCYFNGGGVFVPGKDMDTENTEVVAEYSQD
TEVPNSGRSAVVKMNVGEGRAVLSGIHPEFNPSMMKKGDQHIDAVIEELENFEKERLAFL
RHLMTLLGLKTNPDTTDMTLTSLYVTGNGVAKLLKDLDVSEENRVFSAPNDTFFFGEKPS
GDSNHTHVIPMVGDVPASELTPHFDHKLYYQSLRAPELGSTLLYGEVLTSTSTLLDKNYN
LLRHLPNGFTAVGTVQLSGRGRGNNVWVNPIGVLAVSTVLRINFNPFGQNTSIIFVQYLA
SLAMVQAIKNYGPGYSEVPVKLKWPNDIYAANPGSEMVGSTDAYLKIGGVIVNSNVFDGQ
YMLVVGCGVNVTNSAPTTSLNMLINSMNEKNGTTLEHYRTEVLLAKFLETFEAMMDAFKN
HGFSIFEPLYYSSWLHQDAQVRLEHYGNVKATVKGISMDQGMLLVQEEGSGRVIELQPDG
NSFDMMRGLLKRKE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgctggtgtataacggtccaggatctacccccgagtcagtcaagcatgccacc
gagtctctgcgaaagttgctgtctccttactactctgttcacaatgtcgacgccgaggtg
atcaagaacgaaccctggactgagagcaccgcactgctggtgatgcccggaggagccgat
ctgccctactgttcggacctaggtggaccaggaaacaagttgattcgaaattggattcga
gctggaggcaagtaccttggtttctgtgctggaggatactatggagcccaaagggttgag
tttgaagagggaactgatcttgaggtcataggagacagagaactgtcactctacggagga
aagtgtgtcggatctgcatacaagggctttgtctacgattctcatgctggtgctcgagct
gtgggggtgaactggaagggtagccccttcaagtgctacttcaatgggggaggagtattc
gttcctggtaaggacatggatactgaaaacactgaggtggtggcagagtactctcaggac
acggaggtgccgaactctggacgcagcgccgtggtcaagatgaacgttggcgaaggaaga
gctgtgctcagtggaatccaccccgagtttaatcccagcatgatgaagaagggagatcag
catattgatgctgttattgaagagctggagaactttgagaaagaacgattggcctttctg
agacacctgatgactcttctgggtctcaagacgaaccctgacactacagacatgaccctg
accagtctgtatgtcaccggaaacggagtcgcgaagcttctgaaggatcttgatgtctca
gaagagaaccgagtattctccgcacccaatgataccttcttctttggcgagaagccttct
ggcgactctaaccacacccatgtcatccctatggttggtgatgttcctgcatctgaactg
acaccccatttcgaccacaagctttactaccagagcctgcgggctcctgagcttggctcc
accctgctctatggagaagtcctcacctcaacttctactctgttggacaagaactacaat
ctgctgcgacatcttcctaacggttttactgctgtaggtactgttcagctctccggtcga
ggccgtggaaataacgtatgggtgaaccccatcggcgtgcttgctgtttctactgttcta
agaatcaacttcaacccctttggccagaacactagcatcatctttgttcagtacctcgcc
tctcttgctatggttcaggctatcaagaactatggccccggctattctgaagtccccgtc
aagctcaagtggccaaacgatatctatgccgcaaaccctggaagtgagatggttgggtcc
actgatgcctatctaaagattggaggtgtgattgtcaactccaacgtattcgacggtcag
tacatgcttgttgtgggctgtggagtcaacgttactaacagtgctcctaccacatctctt
aacatgctaatcaactccatgaacgaaaagaatggcactactctggagcactaccgaacc
gaggtgctacttgccaagttcctcgagaccttcgaggccatgatggacgcattcaagaac
catggcttctccatcttcgagcctctctactattccagctggcttcaccaggatgcccag
gtcagattggagcattatggcaatgtcaaggccactgtgaaaggaatcagtatggaccag
ggaatgcttctggttcaggaggagggatctggccgtgtcattgagcttcagcccgatgga
aactctttcgatatgatgagaggactccttaagcgtaaggagtga

DBGET integrated database retrieval system