KEGG   Yarrowia lipolytica: YALI0F04422g
Entry
YALI0F04422g      CDS       T01033                                 

Definition
(RefSeq) YALI0F04422p
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
yli  Yarrowia lipolytica
SSDB
Motif
Pfam: cNMP_binding RIIa Cupin_2 Cupin_3
Other DBs
NCBI-GeneID: 2908883
NCBI-ProteinID: XP_504992
UniProt: Q6C2X0
Position
F:complement(join(681776..682902,683615))
AA seq 375 aa
MTLPPAYVDELNLLNREVTTKQPTDILRFCADYFNERLAKREEADDDGPRSKPLGGGFRE
PGFGSSSRSTDGSLFRSSFADTSSEGPGSASSEPAAPFTRRTSVSAESIAPGAFAGAASG
VASNNLSAEQLESLYKSVSHNFLFGNLDEEACRSVLQSLQEKKCDSGEKIITQGDEGDYF
YIVESGAVEFIKDGVKVNSSGPGSSFGELALMYNAPRAATVVATQPCVLWSLDRVTFRKI
LLDGTHQRRSMYDGFLKEVPILSDLGSYERNKLADALTSQVVEPGTAVITEGEAGDAFYL
VESGEAEVTKKGESGVVATLKQGDYFGEVALLNDLPRQATVTAKTKLKVATLGKDGFQRL
LGPVLDHLKENDPTK
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaccctaccccccgcttacgtggacgaactcaaccttctcaaccgcgaagttaccacc
aaacagccgaccgacattctgcggttctgcgcggactatttcaacgaacggctggccaaa
cgagaagaggctgacgacgacggaccccgttccaagcccctgggcggcggattccgagag
cctggcttcggctcctcttccagaagcacagacggctcattgttccggtcctcgtttgcc
gacacgtcatcagagggccccggctctgcctctagtgagcctgctgcgcccttcactcgt
cgaacctctgtttctgccgagtccattgctcccggtgcctttgccggtgctgcctccggc
gtcgcctccaacaacctctctgccgagcagcttgagtctctctacaagtctgtgagccac
aactttctgtttggcaatcttgacgaggaagcatgccggtccgttctgcagtcgttgcaa
gaaaagaagtgcgacagcggcgaaaagatcatcacccagggcgacgaaggagactacttt
tacattgtggagagcggcgctgtcgagttcatcaaggatggcgtcaaggtgaactcttcc
ggacccggctcttcgtttggagagctcgccctcatgtacaacgctccccgagcagccacc
gtggtggccactcagccctgtgtactgtggtcgctggaccgagtcactttccgaaagatt
ctgctagatggcacccatcagcgacggtccatgtacgacggctttctcaaggaggtaccc
attctcagcgatctgggttcgtacgagcgaaacaagcttgccgacgctctcacgtcccag
gtggttgagcccggaactgccgtcatcaccgagggagaggctggagacgccttttacctc
gtggagagcggagaggctgaggtgactaagaagggcgagtctggcgtggtggctactctt
aagcagggtgactactttggagaggtagctctgttgaacgatctgcctcgacaggccacc
gtgactgccaagaccaagctcaaggtcgctactcttggtaaggatggatttcagagactg
ctgggtcctgtcttggatcatttgaaggaaaatgaccccacaaagtag

DBGET integrated database retrieval system