KEGG   Yarrowia lipolytica: YALI0F13959g
Entry
YALI0F13959g      CDS       T01033                                 

Definition
(RefSeq) YALI0F13959p
Organism
yli  Yarrowia lipolytica
SSDB
Motif
Pfam: OPT KdgM
Other DBs
NCBI-GeneID: 2908181
NCBI-ProteinID: XP_505391
UniProt: Q6C1S1
Position
F:1881552..1884176
AA seq 874 aa
MDSPTEEKFNDKKSPFEKDAIEVDFEAAEVTDISFVDYVGEKLNFVPDENGEHTKNVRLM
ASFVAEMTEEEAEEILLKFIPLHEDDYNLRLEQKEYLKSLVKGEKEAPDPTTYSMDLRIE
AAAIKHWSPYVEVRAVTDCWDDMDEPCETIRSYAIGLVWLLVGCFVNQFFIFRFPSISIS
SDVLQLLTYPCGEFLARVLPDWGFTFRGTRITLNPGPWTRKEQMFATFFLSGGDGSTYVS
AYNLPTQLLPMYYDQKWATFGYQIMLTLSSQYIGFGFAGILRRFAIYPTKAMWPMQMPTL
ALNRALLDPERKQSINGWTISKYWFFLVVFAGSFVYYWIPDYLFAALSNFNWMTWIAPNN
VNLALLTGQSGMGINPIPTFDLNVIGVGNVVTPWWSVVNILVGAILGTFTIIGVYWSNIR
WTAYLPMNTPGIFNNKGGSYKVTKILTNGVFDEEKYQKYGPPLWGAANLVLYGSFFSLYT
LGFVYTMLAYWRDMCTAAVDFYNGIAFWNGRKRTEVDSPFARQLKKYPDVPDWWFFLILL
ISIGFCIGTVKGWPTSTPVWGIFFVLGINVVFLVPICLLQAYTGNGFALNVLVEIICGYA
LNGRPTALNILKAYGVNVDSTSQGFVSVWKTGMYAYVPSRAIFRTQILSTLINAFVTVGI
LQYQLTLTDICTPAQRATTKFTCPNQNVFYSASVLFGAIGSKRVFGTGGGDGLYPFLKWC
FLIGAVVALIFFAIQYTIPAYIGKRYPERKEAMVRLSERLGKINPVVINMGFLQFAPGNL
SYITGGVYLAAFWTLYLKKRYTEWWAKYTYVMVAGVNVGIALAAIIVFFALQYSDIELSW
WGNNVPYAGADGNETPLLTLAPGQLIGPQPGHFP
NT seq 2625 nt   +upstreamnt  +downstreamnt
atggactctcccaccgaggaaaagttcaacgacaaaaagtccccctttgagaaggacgcc
atcgaggtggacttcgaggctgctgaggtcaccgatatctctttcgttgattacgtcggc
gaaaagctcaattttgtccctgacgaaaatggcgaacacaccaagaatgttcgtctcatg
gccagttttgtcgctgagatgaccgaggaagaagctgaggaaattcttctcaagttcatc
cccctccacgaagatgattacaatctgcggttggagcaaaaggaatatctgaagtcgctt
gtgaaaggcgagaaagaagcacctgaccccacaacctactctatggatctccgaatcgaa
gctgctgccatcaagcattggtcgccttacgtcgaagttcgagccgttaccgattgttgg
gatgatatggacgaaccttgcgagacaatcagatcttatgccatcggcttggtctggctt
cttgtcggatgcttcgtgaaccagttcttcatcttccgcttcccttccatctccattagc
tccgacgtcctgcagctgctcacctatccatgtggagagttcctggctcgagttttgccc
gactgggggtttactttccgaggaacccgaatcactctcaaccctggtccttggacaaga
aaggagcagatgtttgcgaccttcttcctcagcggtggtgatggttccacttatgtgtcg
gcctacaacctccccacccagctcctgcccatgtactacgatcagaaatgggccaccttt
ggttaccagattatgttgaccctttcttctcagtacattggttttggattcgctggtatc
ctgcgacgatttgccatctaccctaccaaggcaatgtggcctatgcaaatgcccactctg
gcgctcaaccgagccctactggatcccgagaggaagcagagcatcaacggatggaccatt
agcaagtattggttcttcctggtggtgtttgcaggctcattcgtctactattggattccc
gactacctgtttgcagctctcagtaacttcaactggatgacatggatagctcccaacaat
gtaaacctggctcttctcactgggcagtctggaatgggtataaaccccatccccaccttt
gatcttaacgtcattggcgtgggtaacgtcgtcactccgtggtggtcagttgttaacatt
cttgtgggagctattctaggaacctttacaatcattggtgtatactggtccaacatcaga
tggaccgcctatctgcctatgaacactcctggaatcttcaacaacaaaggaggtagctac
aaggtgaccaagatcctgactaatggtgtttttgacgaggagaagtaccagaagtatggt
cctccactgtggggagctgctaacctggtactctacggttctttcttttctctctacacc
cttggctttgtttacaccatgctggcttactggagagatatgtgcacagctgccgtggac
ttttacaacggtattgccttctggaacggacgaaagcgaaccgaggttgactctcctttt
gcccgacagctcaaaaagtaccccgatgtccctgattggtggttctttcttattcttctc
atctccattggcttctgcattggcactgtcaagggctggcccacttccactcctgtctgg
ggtatcttctttgttctcggcatcaacgtggtcttcctagtccctatctgtctccttcaa
gcttacactggtaacggatttgccctcaacgtgcttgtggagattatttgtggctatgct
ctcaacggacgacctactgcactcaacattttaaaggcatacggagtcaacgtagactcc
acctctcagggctttgtgtctgtgtggaagactggaatgtacgcctacgtgccttctcgg
gccattttccgaacccagatcctctccaccctcatcaatgcgtttgtcaccgtcggaatt
ctccagtaccagctcaccttgacagatatttgcaccccggcccagcgagctactaccaag
tttacttgccccaaccagaacgtcttctactctgcatcggttctatttggagctatcgga
tccaagcgagtttttggaaccgggggaggggatggcctttaccccttccttaagtggtgt
ttcctcattggagcagttgttgctctcattttcttcgccattcagtacaccattccggcc
tacattggcaagcggtaccccgagagaaaggaggccatggttcgactctcggagcgactt
ggaaagattaaccccgttgttatcaacatgggcttccttcagttcgctcctggcaaccta
tcatacattactggaggtgtttatctggcagcattttggactctgtacttgaagaagaga
tacactgagtggtgggccaagtacacctatgtgatggttgcaggtgtcaatgtcggtatc
gccctggcagcaatcattgtgttctttgccctccaatacagcgacattgagctcagttgg
tggggaaacaatgtgccttacgctggtgccgatggtaatgaaactcccttattgacattg
gctccaggccaacttattggtcctcagcccggtcacttcccttag

DBGET integrated database retrieval system