KEGG   Yarrowia lipolytica: YALI0F32043g
Entry
YALI0F32043g      CDS       T01033                                 

Definition
(RefSeq) YALI0F32043p
  KO
K19844  GTPase-activating protein BEM2
Organism
yli  Yarrowia lipolytica
Pathway
yli04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:yli00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YALI0F32043g
SSDB
Motif
Pfam: RhoGAP RasGEF_N RasGEF PH
Other DBs
NCBI-GeneID: 2908125
NCBI-ProteinID: XP_506119
UniProt: Q6BZP3
Position
F:join(3967026..3967431,3967484..3967511,3967798..3967862,3968226..3968349,3968647..3968654,3968715..3973618)
AA seq 1844 aa
MGWGKKSSSSAVPKPPAQPPKSPAKPPSSSASQPSSRDPAIVPRADCKKNYYYQQMLHRQ
LNDDGSTDNLATRNSFSSSENKTIREDIRMGDQEVLRDIRELKSAGSNVRRSRSPQLRPP
SVHQRLPSDDSMSNSTDYYVEPLNSPLPSISTSDTSLTASTAFSRDHPSVVNSKAAVASV
KSAKSDISMRSTSKSVERNPFTGVITTKHDMEHEGWLNNSLTPGAQWRLSRGVVRNGQLL
VYKPPSDLSNRFLDPDAPRTQPSSTHTAISAPFNAAPVSDGMLSHASAEPHPSLELDSSG
TRIMGGTVEAVCHQLLFGDDDLLAESIVYVLPLFTDVVYALDKMCEYIIGPVRDSRSSLA
RYQERAVARAAMAVRKIQDDFSGMLLETSICSALLKLIDGIGALSDQVSTDLKVSVFKKQ
RHMGDLLTPSREGTLWSVQPKLPESVNERLQSFLVFTEQQNQLGAMQSSSASSSSSHSSQ
FGSSSSPQTFPPDLFLDTSIDLLASQVYYFHLQFSGAWSPASDMSLLFGGRWNYWRHNPL
IFDSLSVHFLGGVLLEHLFSGSGAVSSAYRGKLLSHWISLGNALKNCGDMVGWLGIAGVV
CSPPVLRLRDSWGFVSTEIKDSVTKEWAPVVFDLERRLRVTDMSRKSTYHVLAPQGIGQS
YPKERVVPFFGDLCVRYEDGSSFRQCESRLNRIRTAFERWQTYLDQVPQIDTFDSAAEPI
SALQRMLYYLLNRHSQGNIPFHVSNKEPISALLKMSLQCEPSSSGRYLPHFYNQQLPLLM
GSFVPTVFTDVTPSYRLFSKTDLLTFAGFGSPTKRSGTGISSPLRSLPSGTSGTEVDQFA
RRYVSQFSTQHPLICSLRDIMNVGSSMIQGDDVLLKVVSEGPEGSDPTVVVKAASLDRLI
DILILGVGHFAPRVKMDMDLYTLTFFATFRSFCSPTQLLDAFRRRFVGAQSGSTSLTMPR
TFDQKFPDWDSTHIPEKQPDYRLMAQIQIGILEACFLWVSQYFIDFVNEYAVRELFLDFL
ATLEVEISRWGSVVFNSEDIVLYRESLEGLHKKLRKLFIKKSYRPVSAPPKIPYFGPSSK
YIQMPINCGISDVESWISEVDLMAAHIFALVPLKDWMSLYETLEVQGVEPLGFFAFRTPS
MATEDEVIVQSVYTYFETLFRDKPEDRVLLNLPFAVQELLRLHNNFVSYLTAQLTDLSIR
PEIRVARMETLLKGIGICRRRMKAARVFEMSPMADPEEGPPPLSPSVAPAIPSFVEVALA
AAAIRPESRLFTGSWFAAAKECGSSTADSLESIIPYVDGQLQNKPLTPCVGWLIERMLEA
SCHVPNMCVETPKLINFDKRRYAYNLVGNVCDIRPLDEQQDMNLPEQTKRMSFLINLSKA
SFAIDRKVTKEHAAREAKAYGKSKNRVFTHCVGAELEKIKRDVRQREVLDRKRQHAVRAP
TSSSNSEKRGKSRLGGFLKAVRPISMALGSSWTPPQSQEASGINPLDLPTFSVDKVKPFR
SIPLGHSDIFPVHALSKSMFKIVDSSGEYSFQAASEADSEIWLKALTRAKNSAPQTSQST
RQMGRVFGVPVAVVCEREQAAIPYICEVLLNEIEARGLDEVGLYRISGSLNNVNALKQAF
DNGERPDMNDDRWYDVNTLAGCFKLYLREMPEPLLPLELLPDFVSSTTGPQPDLAGLRAA
ADRMPAPNLNLLRRLVQHLSLVTTHGEQNRMHAVNLAIVFSMSLLPPNASANVSTDLSSM
QTVLKLLIIHCDGVFGSLDGGSTTVVDGASTPSSGQLEAPDMASLTLSESKSTSTVDSLE
MMQAPTSRRRQPAGQNPNRRFSVLNEGTNFSDLAHQFGSQESLH
NT seq 5535 nt   +upstreamnt  +downstreamnt
atgggatggggaaagaaatcgtcgtcatcggcggtccctaagccgcctgcacaaccgccc
aaatcaccagccaaaccgccgtcttcttcagcatcgcagcctagctcccgtgatccggcc
atagttccacgcgcagactgcaagaagaactattactaccagcagatgttgcatcgccag
ctgaatgatgatggtagcaccgacaacctggccacgcgcaacagcttttcgtcgtccgag
aacaagacaatccgagaagacattcgcatgggagatcaggaggtgctgcgtgacatccgc
gagctcaagagcgctggaagcaacgtccgcagatcgcgatcgccccagttgcggccgcct
agcgtccaccaacggcttccctcggacgattccatgtccaattcgaccgactactatgtg
gaacctctaaacagtcctctgccttccatatccacgtcagacacgtctctgacagcttcc
acggcattttcccgtgaccacccgtcagtggtgaactcaaaagctgcggtggccagtgtg
aaatccgctaaatcggatatcagcatgagaagtacatcgaaatccgtggagcgaaatcca
ttcaccggagtgattactaccaaacacgacatggaacacgaaggttggctcaacaactcg
ctaacgccaggcgcacaatggcgcttgtcccgaggagtggtaagaaatggtcaactgctg
gtatacaagccgccgtccgatctatccaaccgattcctcgaccccgacgccccccgaaca
caaccctcgtcgacacacactgccatttcagcaccgttcaacgccgctccagtgtccgat
ggcatgctgtcgcatgcctcagctgagcctcatccgtcactcgaactcgattccagcggc
actcgcatcatgggaggcactgtggaagctgtgtgccaccagcttctgtttggagacgac
gatctgctcgcggaatcgatagtctacgtgctgcccctattcacagatgtggtttatgca
ctggacaagatgtgcgagtacataattggacccgtcagagacagccgctcgagcttggca
cgctaccaagaacgagccgtggcccgagctgccatggctgtgcgaaagatccaagacgac
ttttcaggcatgctgctggaaacatccatctgctcggctttgcttaaactcattgacggt
attggtgctctgtcggaccaggtgagcaccgatctcaaggtcagcgtcttcaaaaaacag
cgccacatgggcgatctgcttacccccagtcgagagggtactctgtggtcagtacaacca
aaactaccagaatccgtcaacgagcggctgcaatcatttctggtgttcaccgagcaacag
aaccagcttggtgctatgcaatcgtcgtctgcgtcgtcgtcgtcatcgcactcttcacaa
ttcggctcgtcgtcgagcccccagacgttcccacccgacctcttcctcgacactagcatt
gatcttctcgcatcgcaggtctactactttcacctgcagttttcaggcgcatggtcgcct
gcgtcagacatgtcgctgctgtttggtggtcgatggaactactggcgccacaatccgctc
atcttcgactctctgtcggtccactttttaggaggagttctgctggagcacctgttttct
ggctctggcgcggtgtcatctgcctacagaggcaagctactctcgcattggatctcgctt
ggaaacgccctcaagaactgtggcgacatggttggctggctaggcattgcgggagttgtc
tgctcaccacctgtactgcgtctacgagactcatggggctttgtgtccacggaaatcaag
gattctgttaccaaggaatgggcccccgtggtgtttgacttagagcggcgtctcagagtc
accgacatgtcgcgaaagtctacatatcacgtgcttgcgccccagggcattggccagagc
taccccaaggagcgggtggtcccatttttcggcgacctgtgtgtccgatacgaagatgga
tcatccttccgtcagtgcgagtcgcgtctgaaccgtatccgtactgcatttgagcggtgg
cagacgtacctggatcaggtacctcagatcgacacctttgactctgccgccgagcccatc
tccgcactccaacgaatgctgtactacctgttgaaccgccattcacagggaaacattccc
ttccacgtgtccaacaaggagcccatctctgcgctgctgaaaatgtcgctgcagtgcgaa
ccgtcgtccagtgggcgatacctgccccacttttataatcagcagcttcctctgctgatg
ggcagttttgtacccaccgtgttcacagacgtgactccgtcgtatcggctcttttccaag
accgatctgctcacttttgcaggatttggctccccaaccaagagaagtggcactggcatt
tcgtcacctcttcggtctctgccttctggtacttctggcactgaggtggatcagtttgcc
cggcggtatgtgagccagttcagtacgcagcatcctctgatttgttccttgcgagacatc
atgaatgtgggctctagcatgatccagggcgatgacgtacttctcaaggtggtttctgag
ggccctgagggctcagatcctactgtcgttgtcaaagctgcttctttggaccggcttatt
gacattctgatccttggtgtgggacattttgctcctcgggtcaagatggacatggatcta
tacacactgacgtttttcgcgacattccggtccttctgctcgcccacccagttgctggac
gcgtttcgacgacggtttgtgggcgcccagtctggctccacgtctcttacaatgcctaga
acttttgatcaaaagttccccgactgggattccactcacatccccgagaagcagcccgac
tacagactgatggcccagatacagattggcattcttgaggcctgcttcctgtgggtgtcg
cagtactttatcgactttgtcaatgagtacgctgtcagagagctctttctggactttttg
gccactctggaggttgagatctctcgatggggaagtgttgtgttcaacagtgaagacatt
gttctctaccgagagtctctcgagggtctgcacaagaagctgcgaaaattgttcatcaag
aagagctatcggcccgtgtctgcccctcccaagatcccttactttggtccttcatccaaa
tacatccagatgcccatcaattgcggtatcagcgatgttgagtcttggatttctgaggtg
gatctgatggctgcccacatctttgctctggtgcctctgaaggactggatgtctctatac
gagactctggaggtacagggcgtggagccattgggcttctttgcattccgaacgccctct
atggccaccgaagacgaggttattgtgcagagcgtctacacctactttgagacgcttttc
cgtgacaagcccgaggaccgggtgcttttgaacctcccctttgcagtacaggaactgttg
cgactccacaacaactttgttagctacctgactgcccagttgacggacctgtccattaga
cccgaaattcgagtggctcgaatggagacgttgctcaagggcattggcatttgtcgtcga
cgaatgaaggctgctcgggtgtttgaaatgtcgcccatggccgatcccgaagagggaccc
cctcctctgtctccctcggttgctcctgccatcccctcctttgtggaggttgctttggcg
gctgcagccatccgacccgagtcccggctcttcaccggctcgtggtttgctgctgccaag
gagtgtggttcatccactgccgactctctggagtccatcataccgtacgtggatggccag
ctccagaacaagcctctgactccctgtgtaggctggctgattgagcgaatgttggaggcg
tcgtgtcacgtgcccaacatgtgtgtggaaactcccaagctcatcaactttgacaagcgg
cggtacgcctacaatctggtggggaatgtgtgcgacattagacccctagatgaacagcag
gacatgaacttgcccgaacagaccaagcgaatgagctttttgatcaacctgtccaaggct
tcgtttgcaattgaccgtaaggtgaccaaggagcatgccgcccgcgaagccaaggcctat
ggcaagtctaagaaccgggtttttacccactgtgtgggtgctgagctggagaagatcaag
cgagatgttcgacagcgagaggttctcgatcgaaagcgccaacacgccgttcgagcgccc
acctcgtcttccaactcggaaaagcgaggcaagtcgcgtctgggaggctttctcaaggct
gtgcgacccatatccatggctctgggctcgtcttggactcctccgcaatcccaggaggca
tctggaatcaatcccctggatctccccaccttttcggtggacaaggtcaagccgttcaga
tccattcctctcggtcactccgacattttccctgtgcatgcgctgtccaagtccatgttc
aagattgtggactcttcgggcgagtactcgttccaggctgcgtctgaggccgacagcgag
atttggctcaaggcgctcactcgggccaagaacagtgctcctcagacgagccagtccact
cgacagatgggtcgggtgtttggcgtgcccgttgctgttgtctgcgaacgagagcaggct
gctattccttacatttgtgaggtgttacttaacgagattgaggctcgaggtctggacgag
gttggtctgtatcgaatttccggttctctcaacaacgtcaatgctctcaaacaggccttt
gacaatggtgagcgtcccgatatgaacgacgaccgatggtatgatgtcaacactctggca
ggctgctttaagctgtatctgcgagagatgcccgagccgctgcttcctctggagctgctc
cctgactttgtgtcttccaccacaggtccacagcctgacctggctggccttcgagctgct
gccgatcgaatgccggcacccaacctcaatttgctgcgacgtctggtgcaacatctgtct
ctggtgaccacgcacggcgagcagaaccgaatgcatgcggtaaacctggccattgtgttc
tccatgtccctgttgccgcccaatgcctcggccaatgtttctacggatctcagcagtatg
cagacggttctcaagctgctcattatccactgcgatggagtgtttggcagcctggatgga
ggatctactacggttgtcgatggtgcatcgacaccatcgtctggccagctggaggccccc
gacatggcttcgctgactctgtccgagtccaagtcgacttcaacggtggactctctagag
atgatgcaggcgcccacttctcgtcgacgacagcctgcgggccaaaaccctaacagacga
ttttccgtgctcaatgagggcaccaacttttctgacctggctcatcagtttgggtctcag
gagagtttgcattaa

DBGET integrated database retrieval system