KEGG   Yersinia massiliensis: DA391_00130Help
Entry
DA391_00130       CDS       T05402                                 

Definition
(GenBank) glycine--tRNA ligase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
yma  Yersinia massiliensis
Pathway
yma00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:yma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DA391_00130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:yma01007]
    DA391_00130
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:yma03016]
    DA391_00130
Enzymes [BR:yma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     DA391_00130
Amino acid related enzymes [BR:yma01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   DA391_00130
Transfer RNA biogenesis [BR:yma03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DA391_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AVX36207
UniProt: A0A2R4NJB9
Position
28681..30750
Genome map
AA seq 689 aa AA seqDB search
MTQQTFLVEIGTEELPPKALRSLAEAFAANLTAELDNANLPHGEVIWYAAPRRLAVKVMN
LSAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTDKGEWLLYRA
HVKGQSAQLLLADMVNAALSKLPIPKLMRWGDKETQFVRPVHTVTLLLGSELIPGTVLGI
DSDRIIRGHRFMGEAEFALESADQYPQALLERGKVIADYELRKAMIKRDAELAAQKIGGV
ADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYDTAGNLLPN
FIFVTNIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDNLPRLETVLFQQQLGT
LRDKTDRIQALAGWVAAQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLPLDLQTLTEEAVRLYGSKLTNAKVVDEVIEFMLGRFRAWYQDEG
HSVDTIQAVLARRPTRPADFDARVKAVTYFRTLDAAATLAAANKRVSNILAKSTDTLNDH
VRASVLKEPAELKLATHLVVLRDKLEPVFAAGQYQEALVELAALRETVDEFFDSVMVMAE
DNEVRVNRLTLLSKLRELFLQVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagactttcctggtggaaatcggcacggaagagttgccgccgaaggctctt
cgttctctggccgaagcttttgctgctaatcttaccgccgagctggataacgctaatttg
cctcatggtgaggtgatttggtatgccgcaccgcgtcgtttagcggtaaaagtgatgaat
ttaagtgcagcgcaagcggatcgtgaagttgaaaaacgcggtccagccattgcacaagcc
tttgatgcagaaggtaaaccgagcaaagcggctgaaggttgggcgcgcggttgtggtatt
accgttgatcaggctgagcgtctggtaaccgataaaggcgaatggctgctgtatcgcgct
catgtcaaagggcaatccgcacagcttctgctagcggatatggtcaatgctgcactgagt
aagttgccgatccctaaactgatgcgttggggtgataaagagacgcaatttgttcgtcca
gttcataccgtcaccctgttattaggcagcgaattgattcctggtaccgttttaggtatc
gattcagaccgcattattcgtggtcaccgctttatgggtgaagctgaatttgcccttgag
agtgccgatcaatacccgcaagccctgctggaacgcggcaaagtgattgccgattatgaa
ttgcgtaaagcgatgattaagcgtgatgcagaactggcggcgcagaaaattggcggcgtg
gctgatttgagcgaaagcttgctggaagaagtggcatcactggtggaatggccggtggta
ctgacggccaaatttgaagagaaattcttggctgtacctgcggaagcgctggtgtacacc
atgaaaggtgaccagaagtatttccctgtgtatgacacggccggtaacttgctgccaaac
ttcatttttgtcaccaacatcgaatctaaagacccacagcagatcatttctggtaacgag
aaagtggtgcgtccgcgtctggctgatgcggaattcttctttaataccgaccgtaaaaaa
cgtttggaagataacttaccgcgtctggaaaccgtgctgttccaacagcaactgggtacg
ctgcgcgataagacggatcgtattcaggcgttggcaggttgggttgcggctcaaatcggt
gctgatgttaaccatgccacgcgtgctggcttgctatccaagtgtgacctgatgaccaat
atggtcttcgaattcactgacacccaaggtgtgatggggatgcactatgctcgtcacgat
ggtgaagctgaagacgtcgcggtggcattgaatgagcaatatcagcctcgtttcgcgggt
gatgatttaccgtcaaacccggttgcctgtgcactggcgattgccgataagatggacaca
ctggctggtatcttcggtatcggtcaacacccgaaaggcgataaagacccatttgcactg
cgccgtgccgctttaggtgtgttgcgtattatcgtcgagaagaacttaccactggatctg
caaacgctgaccgaagaggccgtgcgcttgtatggtagcaagctgaccaacgcgaaagtg
gtcgatgaagtgattgagttcatgctgggtcgtttccgtgcctggtatcaggatgaaggt
cacagtgtcgataccattcaagcggtactggctcgtcgcccaaccagaccggctgatttt
gatgctcgagttaaggcggtgacctatttccgcacacttgatgctgctgccacgctggct
gctgcgaacaaacgtgtctcgaatattttggcgaaatcgacagatacgctgaatgaccat
gttcgtgcctcggtgttaaaagagcctgctgaactgaaactggcgactcatctggttgtc
ttgcgcgataagctcgaaccggtctttgctgcaggtcaatatcaggaagcactggtagaa
ctggctgcgctgcgggaaacggtcgatgaattcttcgatagcgtaatggtaatggcagaa
gacaatgaagttcgggttaaccgactgacattgttgagtaagttacgtgagttgttcttg
caggttgccgatatttcgctgttacagtaa

DBGET integrated database retrieval system