KEGG   Yersinia massiliensis: DA391_00230Help
Entry
DA391_00230       CDS       T05402                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
yma  Yersinia massiliensis
Pathway
yma00051  Fructose and mannose metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DA391_00230
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     DA391_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AVX36224
UniProt: A0A2R4NJE4
Position
complement(51729..52892)
Genome map
AA seq 387 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKSYQVNVVGEQARVEEV
NNVSAVNSGSPEVVALIAEADIVTTAVGPQILARIAGTVAQGLITRHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFAALPESEQAWVEQHVGFVDSAVDRIVPPSEAGSTDILAVTVETFS
EWIVDGTQFKGQPPEIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGHQTIRDAIL
DPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYINKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHDNLVTGIAAAMSYRSEQDPQAQELVELLAKLGPKAALAQ
ISGLPADSEVVEQAVNVYNAMQDKLAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggccgaggctttatcggtaaacttctt
gctgatgccggtgcgcaattgaccttcgctgatgttaatcagccgctgctggatgaactg
aataaacgcaaaagttatcaggtcaatgtggtaggcgaacaggcaagagttgaagaggtt
aacaacgtcagcgcagtcaacagtggtagcccagaagtcgttgccctgatagcagaagca
gatattgtcactaccgcagttggcccacagattctcgcccgcatcgccggtacggtggca
cagggtctcatcacccgccatcaacaaggtaacacccgcccactgaatattattgcctgt
gaaaacatggtgcgtggcaccagccagttaaaacaacatgtgtttgctgccttacctgaa
agtgagcaagcgtgggttgagcagcatgtcggcttcgtcgattctgcggttgaccgcatt
gtgccgccgtcagaagcgggcagcacggatattttggccgttacggtagaaacgttcagc
gagtggattgtcgatggtacccagtttaaagggcagccaccagaaatcgcaggcatggaa
ttaaccgataatttgatggcctttgtggagcgtaaactcttcaccctaaacaccggtcat
gccattacggcctatttgggccagcttgccggtcaccagactattcgcgatgccattctt
gacccagcagtgcgccagacagtgaaaggcgcgatggaagaaagtggtgcggtactgatt
aaacgctatgcctttgatccacagaaacacgcagcctatatcaataagatcctctcccgt
tttgagaacccgtacctgcatgacgatgttgagcgcgtcggtcgtcaaccgctgcgtaaa
ctgagtgccggtgaccgtttgatcaaaccgctgttggggacattggagtatcaattgccg
cacgataacttggtaaccggcatcgccgcagccatgagctatcgcagtgagcaagatcca
caagcgcaggaattggtggagttactggcaaaattagggccgaaagctgcgttagcgcaa
atttcaggcttgcctgccgatagcgaggttgtcgaacaggcggtgaatgtgtataacgcc
atgcaggataagctggcgcactga

DBGET integrated database retrieval system