KEGG   Yersinia massiliensis: DA391_12045Help
Entry
DA391_12045       CDS       T05402                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
yma  Yersinia massiliensis
Pathway
yma00480  Glutathione metabolism
yma00590  Arachidonic acid metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DA391_12045
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DA391_12045
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DA391_12045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AVX38335
UniProt: A0A2R4NQD5
Position
complement(2580541..2581095)
Genome map
AA seq 184 aa AA seqDB search
MSHPIYSISVKTIDHQSVQLEKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYHQQGFEV
LGFPSNEFAGQEPGSDEEINAFCRGTFGVEFPMFSKIEVNGPQRHPLYQQLIAAKSVAIK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGVVLERFAPDMTPEDPIILDAINRA
LGYH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatccaatctattccatctcagtgaaaaccattgatcatcaatctgttcaacta
gaaaaatataaaggttcggttctgttagtggtcaatgtggcttctcagtgtggcctgact
aagcagtatgaagggttggagaatctgtataaaacctatcatcaacaaggttttgaagta
ttaggtttcccaagcaatgagtttgcaggccaagaacctgggagtgatgaagagataaac
gctttttgtcgcggcacatttggtgttgaattcccaatgttcagcaaaattgaagtgaat
ggcccgcaacggcatccgttgtatcagcaattaatcgccgccaaatctgttgctatcaaa
cccgaaggtagtgagttttatcagcgtttagcgagcaaggggcgcgagccaaaacagccg
ggtgatattttgtggaattttgaaaagtttctgattagccgtgatggtgtggtactcgag
cgcttcgcccctgatatgacgccagaagatcccattattcttgatgcgattaaccgcgca
ctgggttaccactaa

DBGET integrated database retrieval system