KEGG   Yersinia massiliensis: DA391_19180Help
Entry
DA391_19180       CDS       T05402                                 

Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
yma  Yersinia massiliensis
Pathway
yma00760  Nicotinate and nicotinamide metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DA391_19180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yma03000]
    DA391_19180
Enzymes [BR:yma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     DA391_19180
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     DA391_19180
Transcription factors [BR:yma03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DA391_19180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 CTP_transf_like Citrate_ly_lig AAA_16 MMR_HSR1 HTH_37 HTH_35 ABC_tran FAD_syn AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AVX39594
UniProt: A0A2R4NTZ6
Position
complement(4143952..4145235)
Genome map
AA seq 427 aa AA seqDB search
MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLELEFP
RREKKVGVVFGKFYPLHTGHIFLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKKFMAEKGIIPSFIYSSES
QDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SDRDRKSFQNLLEQMLRSNNIEYVHVESADYDERFLRCVELVQQLLAADLQRLARPSVLV
EAREESR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtttgactatctcaaaaccgcaattaagcaaaagggttgtaccttacagcag
gtcgctgaagccagcggcatgacgaaaggctatttaagccagttgctcaacgacaaaatt
aaaagccccagtgcgcaaaagcttgaagctctgcaccgttttcttgagctggaatttcca
cgccgcgagaaaaaagtcggcgtagtgtttggtaaattttacccgctccacaccggccat
atctttttaatccaacgtgcctgtagtcaggttgacgagctgcatgtcattttgtgccac
gatgagccacgagatcgcgagctattcgaaaacagttcgatgtcacagcagccgaccgtc
agcgaccgcctacgctggttactgcaaacctttaagtatcagaaaaatatccacattcat
tcctttgatgaacatgggattgagccttatccgcacggttgggatgtgtggagccgtggc
gttaagaaatttatggcggaaaagggcatcatccccagttttatttactccagtgaaagt
caggatgcgccgcgttaccgtgagcagctcggcatcgaaacgattctgatcgacccacag
cgctcatttatgaatatcagtggccgccaaatccgccgcgaccctttccgctactgggat
tatattccaacagaagtgaagcccttttttgtccggacggtggcgatactcgggggggaa
tccagcggtaaatcaacgctggtcaataagttagccaatatcttcaataccaccagtgcg
tgggaatatggccgcgattatgttttctctcatctgggtggcgatgagatggcacttcaa
tattcagattatgacaagatcgcgctcggacaagcgcagtacgtagattttgcggtgaag
tacgccaataaagtggcgtttatcgataccgattttgtgaccacgcaggcgttctgcaaa
aaatatgaggggcgcgaacaccccttcgtacaagcgttaattgatgaatatcgctttgat
ctggtgattttgctggaaaacaacacgccgtgggtggccgatggtttacgcagtcttggc
agtgatcgtgaccgtaaatcattccagaacttattggagcagatgttacgcagcaataat
attgaatacgtgcatgttgagtcagccgattatgacgaacgtttcttacgctgtgtagag
ctggtgcagcagcttttggccgccgacctgcaacgccttgcccgcccttcagtattagtt
gaagcgcgggaagagtcgcgatag

DBGET integrated database retrieval system